SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003774 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000003774
Domain Number - Region: 224-351
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0701
Family Arfaptin, Rac-binding fragment 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003774   Gene: ENSPANG00000002089   Transcript: ENSPANT00000004693
Sequence length 439
Comment pep:known_by_projection chromosome:PapAnu2.0:2:27994401:28064377:-1 gene:ENSPANG00000002089 transcript:ENSPANT00000004693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAALAVVTTSGLEDGVPRSRGEGTGEVVVERGPGAAYHMFVVMEDLVEKLKLLRYEEEF
LRKSNLKAPSRHYFALPTNPGEQFYMFCTLAAWLINKAGRPFEQPQEYDDPNATISNILS
ELRSFGRTADFPPSKLKSGYGEHVCYVLDCLAEEALKYIGFTWKRPIYPVEELEEETVAE
DDAELTLNKVDEEFVEEETDNEENFIDLNVLKAQTYHLDMNETAKQEDILESTTDAAEWS
LEVERVLPQLKVTIRTDNKDWRIHVDQMHQHKSGIESALKETKGFLDKLHNEITRTLEKI
GSREKYINNQLENLVQEYRAAQAQLSEAKERYQQGNGGVTERTRLLSESQRRKKPWKKVM
EELEKVKQEMEEKGSSMTDGAPLVKIKQSLTKLKQETVEMDIRIGIVEHTLLQSKLKEKS
NMTRNMHATVIPEPATGFY
Download sequence
Identical sequences ENSPANP00000003774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]