SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003778 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003778
Domain Number 1 Region: 3-107
Classification Level Classification E-value
Superfamily EF-hand 4.87e-23
Family Parvalbumin 0.0000077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003778   Gene: ENSPANG00000009238   Transcript: ENSPANT00000009580
Sequence length 110
Comment pep:known_by_projection scaffold:PapAnu2.0:JH684869.1:411819:431091:-1 gene:ENSPANG00000009238 transcript:ENSPANT00000009580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMTDLLNAEDIKKAVGAFSAIDSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKSGFIE
EDELGFILKGFSPDARDLSAKETKTLMAAGDKDGDGKIGVDEFSTLVAES
Download sequence
Identical sequences A0A2I3M017 A0A2K5JUG2 A0A2K5P539 A0A2K6B3T3 A0A2K6MNF0 G7N3R2 G7PFB9 P80050
XP_005567455.1.63531 XP_011710785.1.29376 XP_011819693.1.43180 XP_011893506.1.92194 XP_017712404.1.44346 ENSPANP00000003778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]