SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003781 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003781
Domain Number 1 Region: 11-290
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.52e-89
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000783
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003781   Gene: ENSPANG00000026409   Transcript: ENSPANT00000023925
Sequence length 435
Comment pep:known_by_projection chromosome:PapAnu2.0:13:127466826:127483564:1 gene:ENSPANG00000026409 transcript:ENSPANT00000023925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSLDAARSFLERLEARGGREGAVLAGEFRDIQARSAAWKADGMCSTKAGSRPENMRKN
RYKDVLPYDQTRVVLSLLQEEGQSDYINGNFIRGVDGSLAYIATQGPLPHTLLDFWRLVW
EFGVKVILMACREIENGRKRCERYWAQEQEPLQTGLFCITLIKEKWLNEDIMLRTLKVTF
QKESRSVSQLQYMSWPDRGVPSSPDHMLAMVEEARRLQGSGPEPLCVHCSAGCGRTGVLC
TVDYVRQLLLTQMIPPDFSLFDVVLEMRKQRPAAVQTEEQYRFLYHTVAQMFCSTLQNAS
PHYQNIKENCAPLYDDALFLRTPQALLAIPRPPGGVLRSISVPGSPGHAMADTYAVVQEE
VPLYSQVTPRAQRPGAHAEDVRGMVPGRVPADPSPAASGAYEDVAGGAQTGGLGFNLRIG
RPKGPRDPPAEWTRV
Download sequence
Identical sequences ENSPANP00000003781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]