SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003790 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003790
Domain Number 1 Region: 726-840
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000785
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 2 Region: 1143-1176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000024
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000003790
Domain Number - Region: 1240-1272
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00017
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 1272-1304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000524
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 1336-1368
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00112
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 1097-1246
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00581
Family Growth factor receptor domain 0.0054
Further Details:      
 
Domain Number - Region: 1304-1336
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0393
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 1035-1118
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0942
Family Growth factor receptor domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003790   Gene: ENSPANG00000006249   Transcript: ENSPANT00000004970
Sequence length 1372
Comment pep:known_by_projection chromosome:PapAnu2.0:3:98569470:98611014:1 gene:ENSPANG00000006249 transcript:ENSPANT00000004970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRDFEVHVRQWDCGSLHYPVSCNCGFVAHEGGDIVTFDMCSGQLRESQPYLFVKSQHVT
RNIKISESYLGRKVTIWFASGAFIRADVGEWGMSLTIRAPGVDYRNTLGLCGTFDENPEN
DFHDKNGIQIDQNFNNYVAFINEWRILPGKSMFDTLPISLTSPGKPSYCSCSVDTAAYPS
SNDLGSVSQSEIVSGCKDLSHVSLPSLIPELDVTSEYINSGTLVREINKHTSQDEYNLNF
FPQENNHINLTKLGLNVQKHPGNEKEDALKYLDTKKYTQGQENPSQEMRYNRQNRRKWQN
FYEFLPLFAFPSLSQTDLEELTYFFPEDHTEDVQQEFVPSWPTPSGLTEYSTLTLCQQTL
ANSSIGRLCLAFLGKRIDSVIDMCVKDVLLKDDLSWAEAGVALLENECEKRIVEEGKYNT
EEYGTSIEDILLVLKCPNLCSGNGQCMEWGCACSPSFTSYDCSDSYDKAPEIIELGNAGF
CDVRKSNCMMVRVFGKGFKELPSIKCEVTKLQYNSSEWMPGEPIYTQTVFQNSRAVDCQL
PNDVQQFDTMDLVGGKPIRKWQLKVSNDGYKFSNHKIMVIYDGACQFCGLYKNDSCTVKE
NVCIIDGLCYVEGDKNPTSACLICRPKISRFTWSFLENNQPPVIQVLQDKLQTFYGENFE
YQFVAFDPEGSDIHFTLDSGPEGASVSSAGLFMWKTELLTPQQFTLRLNDDCDAETRVTI
EVTVKSCDCLNGGSCVSDRNFPPGSGVYLCVCLPGFHGSLCEVNTSGCQSNPCGLGSCIS
GFHNYSCDCPPELKGKNCQEDVDECDSKPCFQGVECLNTFGSYHCGSCPKGFYGDGKICH
VETQFLNKFTTHIVVLTRSDKSINKEEDDKDAQGRKRHVKPTNRNALSINFQPPSTEYSL
IGTRFTPTPATVKKLLSMTNNISRSSLKLITAQMDNSVKAISHQISDFEHVDRSLSTNLS
LGELEVSMKKSSSLSMNPNSTHGKAKDDIQNNIQTEMGGYNSQISRSSQDYTQYEDEFVS
SITKAITILPEKFGSNKISPCADSPCFVGVSCVPSSDGHFKCGRCPFGYYGDGVNCRAIC
RYPCGKSRECVAPNVCKCKPGYIGSNCQTALCDPDCKNHGKCIKPNICQCLPGHRGATCD
EEHCNPPCQHGGTCLAGNLCTCPYGFVGPRCETMVCNRHCENGGQCLTPDICQCKPGWYG
PTCSTALCDPVCLNGGSCNKPNTCLCPNGFFGEQCQNAFCHPPCKNGGHCMRNNVCICRE
GYTGRRCQKSICDPMCMNGGKCVGPNTCSCPSGWSGKRCNTPICLQKCRNGGECIAPSIC
HCPSSWEGVQCQIPICNPKCLYGGRCIFPNVCSCRTEYSGVTCEKKIQIRHH
Download sequence
Identical sequences ENSPANP00000003790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]