SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003817 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003817
Domain Number 1 Region: 260-338
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.56e-23
Family Synaptotagmin-like (S variant) 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000003817
Domain Number - Region: 35-73
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00193
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003817   Gene: ENSPANG00000005720   Transcript: ENSPANT00000008286
Sequence length 369
Comment pep:known_by_projection chromosome:PapAnu2.0:1:29537023:29546036:1 gene:ENSPANG00000005720 transcript:ENSPANT00000008286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQRGHPSQEGLWALPSLPMAHGPKPETEGLLDLSFLTEEEQEAIAGVLQRDARLRQLEE
GRVSKLRASLADPGQLKILTGDWFQEARSQRHHNAHFGSDLVRASMRRKKSARGDQAPGS
DGEAEAAVKEKEEGPEPRLTIDEAPQERLRETEEPDFPSPSVPLKGSDPEEASQAQEDPG
QGDLLVCAEKADPELEPASRGGQEPRPPQAQTKAESQILENGEEAPGPDPSLDRMLSSSS
SVSSLNSSTLSGSQMSLSGEAEAVQVRGSVHFALHYEPGASELRVHVIQCQGLAAARRRR
SDPYVKSYLLPDKQSKRKTAVKKRNLNPVFNETLRVRLGPRCCSPLMNRTPLPAGRGGKG
SLEDRRGGY
Download sequence
Identical sequences ENSPANP00000003817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]