SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003865 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003865
Domain Number 1 Region: 247-493
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.45e-36
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 2-81,121-199
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.02e-19
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000003865
Domain Number - Region: 500-645
Classification Level Classification E-value
Superfamily EF-hand 0.00991
Family Calmodulin-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003865   Gene: ENSPANG00000016341   Transcript: ENSPANT00000006852
Sequence length 1187
Comment pep:novel chromosome:PapAnu2.0:2:81429636:81498254:-1 gene:ENSPANG00000016341 transcript:ENSPANT00000006852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIM
IVTTLLQFMFACIGVQLFKGKFYRCTDEAKSNPEECRGLFILYKDGDVDSPVVRERIWQN
SDFNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENIGPIYNHRVEISIFFIIYIIIV
AFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFW
YVVNSSPFEYMMFVLIMLNTLCLAMQHYEQSKMFNDAMDILNMVFTGVFTVEMVLKVIAF
KPKGYFSDAWNTFDSLIVIGSIIDVALSEADNSEESNRISITFFRLFRVMRLVKLLSRGE
GIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQMFGKVAMRDNNQINRNNNFQTFPQ
AVLLLFRCATGEAWQEIMLACLPGKLCDPESDYNPGEEYTCGSNFAIVYFISFYMLCAFL
IINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQP
PLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGNLEQANEELR
AVIKKIWKKTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFRKFKKRKEQGLVGKYPAK
NTTIALQAGLRTLHDIGPEIRRAISCDLQDDEPEETKREEEDDVFKRNGALLGNHVNHVN
SDRRDSLQQTNTTHRPLHVQRPSIPPASDTEKPLFPPAGNSVCHNHHNHNSIGKQVPTST
NANLNNANMSKAAHGKRPSIGNLEHVSENGHHSSHKHDREPQRRSSVKRTRYYETYIRSD
SGDEQLPTICREDPEIHGYFRDPRCFGEQEYFSSEECYEDDSSPTWSRQNYGYYSRYPGR
NVDFERPRGYHHPQGFLEDDDSPICYDSRRSPRRRLLPPTPASHRRSSFNFECLRRQSSQ
EEVPSSPTFPHRTALPLHLMQQQIMAVAGLDSSKTQKYSPSHSTRSWATPPATPPYRDWT
PCYTPLIQVEQSEALDQMNGSLPSLYRSSWYTDEPDISYRTFTPASLTVPSSFRNKNSDK
QRSADSLVEAVLISEGLGRYARDPKFVSATKHEIADACDLTIDEMESAASTLLNGNVCPR
ANGDVGPLSHRQDYELQDFGPGYSDEEPDPGRDEEDLADEMICITTL
Download sequence
Identical sequences ENSPANP00000003865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]