SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003921 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003921
Domain Number 1 Region: 17-140
Classification Level Classification E-value
Superfamily PH domain-like 7e-30
Family Pleckstrin-homology domain (PH domain) 0.000000524
Further Details:      
 
Domain Number 2 Region: 172-262
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000152
Family SH2 domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003921   Gene: ENSPANG00000019724   Transcript: ENSPANT00000013141
Sequence length 295
Comment pep:known_by_projection chromosome:PapAnu2.0:5:60839957:60886805:-1 gene:ENSPANG00000019724 transcript:ENSPANT00000013141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAKKPPKPAPRRIFQERLKITALPLYFEGFLLVKRSGYREYEHYWTELRGTTLFFYTDK
KSTIYIDKLDIIDLTCLTEQNSTEKNCAKFTLVLPKEEVQLKTENTESGEEWRGFILTVT
ELSVPQNVSLLPGQVIKLKKALEELRKEDLNVSIHRVTQACNNRSFNYLCFLSYLCRCFY
TVSRKEATEMLQKNPSLGNMILRPGSDSRNYSITIRQETDMPRIKHYKVMSVGQNYTIEL
EKPVTLPNLFSVIDYFVKETRGNLRPFICSTDENTGQEPNMEGKSEKLKKNPHIA
Download sequence
Identical sequences ENSPANP00000003921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]