SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003943 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003943
Domain Number 1 Region: 1-119
Classification Level Classification E-value
Superfamily EF-hand 3.66e-33
Family Penta-EF-hand proteins 0.00000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003943   Gene: ENSPANG00000004218   Transcript: ENSPANT00000017485
Sequence length 121
Comment pep:known_by_projection chromosome:PapAnu2.0:6:83819:98662:1 gene:ENSPANG00000004218 transcript:ENSPANT00000017485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQF
HDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSI
V
Download sequence
Identical sequences A0A024QZ42 A0A2K5ZR67 A0A2K6BNU6 A0A2K6RU48
ENSP00000485024 ENSPANP00000003943 NP_001254487.1.87134 NP_001254487.1.92137 XP_005340797.1.77405 XP_005556578.1.63531 XP_005985304.1.78601 XP_006928191.1.62641 XP_007087341.1.5354 XP_007959247.1.81039 XP_008532602.1.77740 XP_008850707.1.79516 XP_010341380.1.74449 XP_010351618.1.97406 XP_011232410.1.58354 XP_011708582.1.29376 XP_011825973.1.47321 XP_011915939.1.92194 XP_014590438.1.31192 XP_014703959.1.49734 XP_014942501.1.86478 XP_014956838.1.66739 XP_017194709.1.1745 XP_017375905.1.71028 XP_017519155.1.32401 XP_017723845.1.44346 XP_017825507.1.60252 XP_019293806.1.44245 XP_019293807.1.44245 XP_019668877.1.62641 XP_020752397.1.74333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]