SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003945 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003945
Domain Number 1 Region: 223-404
Classification Level Classification E-value
Superfamily TPR-like 1.61e-26
Family Tetratricopeptide repeat (TPR) 0.0051
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000003945
Domain Number - Region: 103-147
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.0157
Family N-terminal coiled coil domain from apc 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003945   Gene: ENSPANG00000024512   Transcript: ENSPANT00000022169
Sequence length 457
Comment pep:known_by_projection chromosome:PapAnu2.0:19:38784692:38794895:1 gene:ENSPANG00000024512 transcript:ENSPANT00000022169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVQVAAPGIAGLGPERLSPEELVRQTRQVVQGLEALRAEHRGLAGHLAEALAGQGPATG
LEMLEEKQQVVSHSLEAIELGLGEAQVLLAVSAHVGALEAEKQRLRSQARRLAQENVWLR
EELEETQRRLRASEEAVAQLEEEKRHLEFLGQLRQYDPPTETQQSESPPRRDSLASLFPS
EEEERKGPEAAGAAAAQQGGYEIPARLRTLHNLVIQYAGQGRYEVAVPLCRQALEDLERS
SGHCHPDVATMLNILALVYRDQNKYKEATDLLHDALQIREQTLGPEHPAVAATLNNLAVL
YGKRGRYREAEPLCQRALEIREKVLGADHPDVAKQLNNLALLCQNQGKFEDVERHYARAL
SIYEALGGPHDPNVAKTKNNLASAYLKQNKYQQAEELYKEILHKEDLPAPLGAPNTGTAG
DTEQALRRSSSLSKIRESIRRGSEKLVSRLRGEGAAG
Download sequence
Identical sequences ENSPANP00000003945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]