SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003959 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003959
Domain Number 1 Region: 12-195
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.4e-42
Family Eukaryotic proteases 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003959   Gene: ENSPANG00000024538   Transcript: ENSPANT00000028832
Sequence length 240
Comment pep:novel chromosome:PapAnu2.0:8:8422718:8425315:1 gene:ENSPANG00000024538 transcript:ENSPANT00000028832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSFRGKLDMAVVNVTVVMGTRTFSNIHSERKQVQKVIIHKDYKPPQLDSDLSLLLLATP
VQFSNFKMPVCLQEEERTWDRCWMAEWVMTNGYDQYDDLNMHLEKLRVVQISQKECAKRV
NQLSRNMICAWKEPGTNGICKGDSGAPLVCAIYGTQRLFQVGVFSWGIRSGSRGRPGMFV
SVAQFIPWIQEETEKEGKAYTIISGSTRSSLVCVPQYLFLLGLGSQMLLATMFTGDKPNC
Download sequence
Identical sequences ENSPANP00000003959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]