SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003968 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003968
Domain Number 1 Region: 13-80,115-142,226-262,429-481
Classification Level Classification E-value
Superfamily TPR-like 1.3e-17
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 
Domain Number 2 Region: 286-493
Classification Level Classification E-value
Superfamily TPR-like 0.0000000025
Family Tetratricopeptide repeat (TPR) 0.048
Further Details:      
 
Domain Number 3 Region: 81-148,180-203
Classification Level Classification E-value
Superfamily TPR-like 0.00000948
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003968   Gene: ENSPANG00000005495   Transcript: ENSPANT00000002330
Sequence length 671
Comment pep:known_by_projection chromosome:PapAnu2.0:5:72025804:72060387:-1 gene:ENSPANG00000005495 transcript:ENSPANT00000002330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGGSGGVSVPALWSEVNRYGQNGDFTRALKTVNKILQINKDDVTALHCKVVCLIQNGS
FKEALNVINTHTKVLANNSLSFEKAYCEYRLNRIENALKTIESANQQTDKLKELYGQVLY
RLERYDECLAVYRDLVRNSQDDYDEERKTNLSAVVAAQSNWEKVVPENLGLQEGTHELCY
NTACALIGQGQLNQAMKILQKAEDLCRRSLSEDTDGTEEDPQAELAIIHGQMAYILQLQG
RTEEALQLYNQIIKLKPTDVGLLAVIANNIITINKDQNVFDSKKKVKLTNAEGVEFKLSK
KQLQAIEFNKALLAMYTNQAEQCRKISASLQSQSPEHLLPVLIQAAQLCREKQHTKAIEL
LQEFSDQHPENAAEIKLTMAQLKISQGNISKACLILRSIEELKHKPGMVSALVTMYSHEE
DIDSAIEVFALAIQWYQNHQPKSPAHLSLIREAANFKLKYGRKKEAISDLQQLWKQNPKD
IHTLAQLISAYSLVDPEKAKALSKHLPSSDSMSLKVDVEALENSPGATYIRKKGGKVTGD
SQPKEQGQGDLKKKKKKKKGKLPKNYDPKVTPDPERWLPMRERSYYRGRKKGKKKDQIGK
GTQGATAGASSELDASKTVSSPPTSPRPGSAATVSASTSNIIPPRHQKPAGAPATKKKQQ
QKKKKGGKGGW
Download sequence
Identical sequences A0A096MVS7 A0A2K5K4N7 A0A2K5KML9 A0A2K6Q4R7
ENSPANP00000003968 XP_010353530.1.97406 XP_011816628.1.43180 XP_011928859.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]