SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003990 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003990
Domain Number 1 Region: 86-383
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.67e-80
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000146
Further Details:      
 
Domain Number 2 Region: 487-557
Classification Level Classification E-value
Superfamily DUSP-like 0.0000000000955
Family DUSP, domain in ubiquitin-specific proteases 0.012
Further Details:      
 
Domain Number 3 Region: 950-1005
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000004
Family Ubiquitin-related 0.0085
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000003990
Domain Number - Region: 740-814
Classification Level Classification E-value
Superfamily DUSP-like 0.00248
Family DUSP, domain in ubiquitin-specific proteases 0.011
Further Details:      
 
Domain Number - Region: 650-690
Classification Level Classification E-value
Superfamily DUSP-like 0.0144
Family DUSP, domain in ubiquitin-specific proteases 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003990   Gene: ENSPANG00000017055   Transcript: ENSPANT00000008346
Sequence length 1039
Comment pep:known_by_projection chromosome:PapAnu2.0:1:23906150:24007906:-1 gene:ENSPANG00000017055 transcript:ENSPANT00000008346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCSRRNCKGNPNCLVGIG
EHIWLGEIDENSFHNIDDPNCERRKKNSFVGLTNLGATCYVNTFLQVWFLNLELRQALYL
CPSTCSDYVLGDGIQEEKDYEPQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQ
QDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYVTVCNQCGRESKLLSKFYEL
ELNIQGHKQLTDCISEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRF
VFDRQTGHKKKLNTYIGFSEILDMEPYVEHKGGSYVYELSAVLIHRGVSAYSGHYIAHVK
DPQSGEWYKFNDEDIEKMEGKKLQLGIEEDLGMDSFSTWSRLLSCLSLSSHCLSDRFHFI
FKNDAIEPPRLAVVVPAFLQELVDRDNSKFEEWCIEMAEMRKQSVDKGKAKHEEVKELYQ
RLPAGAEPYEFVSLEWLQKWLDESTPTKPIDNHACLCSHDKLHPDKISIMKRISEYAADI
FYSRYGGGPRLTVKALCKECVVERCRVLRLKNQLNEDYKTVNNLLKAAVKGNDGFWVGKS
SLRSWRQLALEQLDEQDGDAEQSNGKMNGSTLNKDESKEERKEEEELNFNEDILCPHGEL
CISENERRLVSKEAWSKLQQYFPKAPEFPSYKECCSQCKILEREGEENEALHKMIANEQK
TSLPNLFQDKNRPCLSNWPEDTDVLYIVSQFFVEEWRKFVRKPTRCSPVSSVGNSALLCP
HGGLMFTFASMTKEDSKLIALIWPSEWQMIQKLFVVDHVIKIMRIEVGDVNPSETQYISE
PKLCPECREGLLCQQQRDLREYTQATIYVHKVVDNKKVMKDSAPELNVSSSETEEDKEEA
KPDGEKDPDFNQSNGGTKRQKISHQNYIAYQKQVIRRSMRHRKVRGEKALLVSANQTLKE
LKIQIMHAFSVAPFDQNLSIDGKILSDDCATLGTLGVIPESVILLKADEPIADYAAMDDV
MQAVCMPEEGFKGTGLLGH
Download sequence
Identical sequences ENSPANP00000003990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]