SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003994 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003994
Domain Number 1 Region: 225-286
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000221
Family PHD domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003994   Gene: ENSPANG00000003133   Transcript: ENSPANT00000012052
Sequence length 300
Comment pep:known_by_projection chromosome:PapAnu2.0:1:9472322:9480466:1 gene:ENSPANG00000003133 transcript:ENSPANT00000012052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSDSCAAAFHSEEYSPSCKRRRTVEDFNKFCTFVLAYAGYIPYPKEELPLRSSPSPANS
TAGTIDSDGWDAGFSDIASSVPLPVSDRCFSHLQPTLLQRAKPSNFLLDRKKTDKLKKKK
KRKRRDSDAPGKEGYRGGLLKLEATDPYVETPTSPTLQDIPQAPSDPCSGWDSDTPSSGS
CATVSPDQVKEIKTEGKRTIVRQGKQVVFRDEDSTGNDEDIMVDSDDDSWDLVTCFCMKP
FAGRPMIECNECHTWIHLSCAKIRKSNVPEVFVCQKCRDSKFDIRRSNRSRTGSRKLFLD
Download sequence
Identical sequences A0A096MVV3 A0A2K6BVD3 F6YEY8
ENSMMUP00000012475 ENSMMUP00000012475 9544.ENSMMUP00000012475 ENSPANP00000003994 NP_001247682.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]