SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003995 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003995
Domain Number 1 Region: 151-460
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.35e-37
Family Arginine methyltransferase 0.001
Further Details:      
 
Domain Number 2 Region: 32-144
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000712
Family Tetratricopeptide repeat (TPR) 0.0099
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000003995
Domain Number - Region: 678-760
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.0914
Family Arginine methyltransferase 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003995   Gene: ENSPANG00000019539   Transcript: ENSPANT00000018632
Sequence length 761
Comment pep:known_by_projection chromosome:PapAnu2.0:5:137659630:137705032:-1 gene:ENSPANG00000019539 transcript:ENSPANT00000018632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNSRLRSRRDAGGGAGAAGRDELVSRSLQSAEHCLGVQDFGTAYAHYLLVLSLAPELKD
NVKETFQYTLFRWAEELDALNRIQDLLGCYEQALELFPDDEVICNSMGEHLFRMGFRDEA
AGYFHKAVKLNPDFSDAKENFYRVANWLVERWHFIMLNDTKRNTIYNAAIQKAVCLGSRS
VLDIGAGTGILSMFAKKAGAHSVYACELSKTMYELACDVVAANKMEAGIKLLHMKSLDIE
IPKHIPERVSLVVTETVDAGLFGEGIVESLIHAWEHLLLQPKTKGESCNCEKYGKVIPAS
AVIFGMAVECAEIRRQHRVGIKDIAGIHLPTNVKFQSPAYSSVDAEETVEPYTTEKMSRV
PGGYLALTECFEIMTVDFNNLQELKSLATKKPDKIGIPVIKEGILDAIMVWFVLQLDDEH
SLSTSPSEETCWEQAVYPVQDLTDYWIKPGDHVMMEVSCQDCYLRIQSISVLDLECEMDV
ARSFTQNKDLLSLGNEAELCSALANLQTSKPDAVEQTCVLESTEIALLNNIPYHEGFKMA
MSKVLSSLTPEKLYQTMDTHCQNEMNSGTGQSNTVQNIPEPFYVLDVSEGFSILPLIAGT
LGQVKPYSSVEKDQHRIALDLISEANHFPKETLEFWLRHVEDESAMLQRPKSDKLWSIII
LDVIEPSGLIQQEIMEKAAISRCLLQSGGKIFPQYVLMFGLLVESQTLLEENAVQGTERT
LGLNIAPFINQFQVPIRVFLDLSSLPCIPLSKPVELLRLDL
Download sequence
Identical sequences ENSPANP00000003995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]