SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004028 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004028
Domain Number 1 Region: 845-946
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 2.35e-29
Family Elongation factor TFIIS domain 2 0.0022
Further Details:      
 
Domain Number 2 Region: 625-694
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000532
Family PHD domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004028   Gene: ENSPANG00000024773   Transcript: ENSPANT00000017136
Sequence length 1964
Comment pep:known_by_projection chromosome:PapAnu2.0:4:59522734:59607014:1 gene:ENSPANG00000024773 transcript:ENSPANT00000017136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGLDDIMDEGVVKESGNDTIDEEELILPNRNLRDKVEENSVRSPRKSPRLMAQVIEQVRS
LRQSTIAKRSNAAPLSNTKKPSGKTVSTPKAGVKQPERSQVKEEVCTPLKPEYHKENRRS
SRNSGQIEVVPEVSVSSSHSSVSSCLEMKDEDGLDSKHKCNNQREADVPSHELTCSLLSE
TCVTIGEKKNEALMECKAKPVGSPLFKFSDKEEHEQNDSISGKTDETVVEEMIATRKVEQ
ESKETVKLSHEDDHILEDPGSSDSSGDAACTNPNKTENSLVGLPSCVDEVTECNLELRDT
MDIADKTENTFERDKIEPLGYCEDAKSNRQLENPEFNKSNLEVVDTSTFEPESNVLENAI
CDVPDQNSKQLNAIESTKIESHETANLQDDRNSQSSSVSYLESKSVKSKHPKPVIHSKQN
MTTDTPKKIVAAKYEVMHSKTKVNVKSVKRNTDEPESQQNFHRPVKVRKKQIDKEPKIQS
CNSGVKSVKNQAHSVLKKTLQDQTVVQIFKPLTHSLSDKSHAHPGCLKEPHHPAQTGHVS
HSSQKQFHKPQQQALAMKTNSHVKEELEHPGIEHFKEEDKLKLKKPEKNLQPRQRRSSRS
FSLDEPPLFIPDNIATIKREGSDHSSSFESKYMWTPSKQCGFCKKPHGNNVRFMVGCGRC
DDWFHGDCVGLSLSQAQQMGEEDKEYVCVKCCAEEDKKTEILDPDTLENQATVEFHSEDK
TMECEKLGLSKHTANDRTKYIDDTVKHKVKILKRESGEGRNSSDCRDNEIKKWQLAPLRK
MGQPVLPRRSSEEKSEKIPKESTTVTCTGEKASKPGSTHEKQEMKKKKVEKGVLNVHPPA
ASASKPSADQIRQSVRHSLKDILMKRLTDSNLKVPEEKAAKVATKIEKELFSFFRDTDSK
YKNKYRSLMFNLKDPKNNILFKKVLKGEVTPDHLIRMSPEELASKELAAWRRRENRHTIE
MIEKEQREVERRPITKITHKGEIEIESDAPMKEQEAAMEIQEPAANKSLEKPEGSEKQKE
EVDSMSKDTTSQHRQHLFDLNCKICIGLGRMAPPVDDLSPKKVKVVVGVTRKHSDNEAES
IADALSSTSNILASEFFEEEKQESPKSTFSPAPRPEMPGTVEVESTFLARLNFIWKGFIN
MPSVAKFVTKAYPVSGSPEYLTEDLPDSIQVGGRISPQTVWDYVEKIKASGTKEICVVRF
TPVTEEDQISYTLLFAYFSSRKRYGVAANNMKQVKDMYLIPLGTDKIPHPLVPFDGPGLE
LHRPNLLLGLIIRQKLKRQHSASASTSHIAETPESAPIALPPDKKSKIEVSTEEAPEEEN
DFFNSFTTVLHKQRNKPQQNLQEDLPAAVEPLMEVTKHEPPKPLRFLPGVLIGWENQPTT
LELANKPLPVDDILQSLLGTAGQVYDQAQSVMEQNTLKEIPFLNEQTNSKTEKIDNVEVT
DSENKEIKVKVDNLSESTDKSAVIGEETSIVGSSSISAGPLTSLSLRGKPPDVSTEAFLT
NLSIQSKQEETVESKEKTLKRQLQEDQENNLQDNQTSNSSPCRSNVGKGNIDGNVSCSEN
PVANTRSPQFINLKRDPRQAAGRSQPVTTSESKDGDSCRNGEKHILPGLSHNKEHLTEQM
NVEEKLCSVEKNSCVQHSDNLKVAQNSPSVENIQTSLAEQAKPLQEDILMQNIETVHPFR
RGSAVATSHFEVGNTCPSEFPSKSITFTSRSTSPRTSTNFSPMRPQQPSLQHLKSSPPGF
PFPGPPNFPPQSMFGFPPHLPPPLLPPPGFGFAQNPMVPWPPVVHLPGQPQRMMGPLSQA
SRYIGPQNFYQVKDVRRPERRHSDPWGRQDQQQLDRPFNRGKGDRQRFYSDSHHLKRERH
EKEWEQESERHRRRDRSQDKDRDRKSREEGHKDKERARLSHGDRGTDGKASRDSRSVDKK
PDKPKSEDYEKDKEREKSKHREGEKDRDRYHKDRDHTDRTKSKR
Download sequence
Identical sequences ENSPANP00000004028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]