SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004049 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004049
Domain Number 1 Region: 266-386
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.24e-52
Family Calsequestrin 0.00000145
Further Details:      
 
Domain Number 2 Region: 163-262
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.88e-26
Family Calsequestrin 0.0000504
Further Details:      
 
Domain Number 3 Region: 41-162
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.43e-19
Family Calsequestrin 0.0000225
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004049   Gene: ENSPANG00000004482   Transcript: ENSPANT00000002823
Sequence length 420
Comment pep:known_by_projection chromosome:PapAnu2.0:1:116504968:116575314:-1 gene:ENSPANG00000004482 transcript:ENSPANT00000002823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRRYLRKGVFARESPRVRGPLFHFILMRTDSSGVRAEEGLNFPTYDGKDRVVSLSEKNFK
QVLKKYDLLCLYYHEPVSSDKVAQKQFQLKEIVLELVAQVLEHKAIGFVMVDAKKEAKLA
KKLGFDEEGSLYVLKGDRTIEFDGEFAADVLVEFLLDLIEDPVEIISSKLEVQAFERIED
HIKLIGFFKSEDSEYYKAFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEPFMDE
PIAIPNKPYTEEEIVEFVKEHQSRPTLRRLRPEEMFETWEDDLNGIHIVAFAEKSDPDGY
EFLEILKQVARDNTDNPDLSILWIDPDDFPLLQLVAYWEKTFKIDLFRPQIGVVNVTDAD
SVWMEIPDDDDLPTAEELEDWIEDVLSGKINTEDDDEDDDDDDDNNSDEDNDDSDDDDDE
Download sequence
Identical sequences ENSPANP00000004049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]