SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004053 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004053
Domain Number 1 Region: 189-269,322-387
Classification Level Classification E-value
Superfamily EF-hand 0.00000000109
Family Calmodulin-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004053   Gene: ENSPANG00000016246   Transcript: ENSPANT00000002792
Sequence length 549
Comment pep:known_by_projection chromosome:PapAnu2.0:1:62131416:62213270:-1 gene:ENSPANG00000016246 transcript:ENSPANT00000002792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSAWKTPRGSDAMPEIMVKIIGSKYFRYLVEKPKIKENENLKTETQTTRQKPMTDNARQ
MSRDPPAPINFTDQQTNYNPDDVKENKHPANNQKSENNQKLLTGAHSSRFLDGKIPSQAN
VHCSSVPTGDQSLSYVHGVPRRKLRDWSLEQMVRGGSDQPEDIGQRPSGTTNEDTFLLAV
VRRELKSRPLRSNLLEKLQKELKILDPISSRFLLQSQLSRLFLKHEVPLQLPTVKILCQR
FSKRGSPEMVNYEKLLWFLNSAASDYPQQNKAAADLRKTESHGTHSQRRKSPSHDLSGRD
SNRKLSLQEKRKEXLRTTNGRLNIDNLNLSFRKEDRSFSGCLPPPKVRAICGKHGLYLTL
SLLETLLNHQDLGYQNEIKWQNFVAMLSTASSDLLSDLPTGKNEKKAPAPPTEPEVPEMS
QSKTEHMKTPEEELQPESSPAETSARKDPLKPLKIRPVSQPFVNPAVKNEAEECETWIDR
FRKLENALYLCDLSNTGVLEKEPARRLIHNYNLIYNLSLSPRKIDQALRRFHLGENMLLE
PALRYLKEL
Download sequence
Identical sequences ENSPANP00000004053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]