SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004067 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000004067
Domain Number - Region: 232-274
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00015
Family Spermadhesin, CUB domain 0.0073
Further Details:      
 
Domain Number - Region: 557-597
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0449
Family Spermadhesin, CUB domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004067   Gene: ENSPANG00000015568   Transcript: ENSPANT00000008691
Sequence length 836
Comment pep:known_by_projection chromosome:PapAnu2.0:2:90238142:90299285:1 gene:ENSPANG00000015568 transcript:ENSPANT00000008691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLNCGVTIALLGVLLLGAARLPRAAEAFEIALPRESNITVLIKLGTPTLLAKPCYIVI
SKRHTTMLSIKPGERIVFTFSCQSPENHFVIEIQKNIDCMSGPCPFGEVQLQPSTSLLPT
LNRTFIWDVKAHKSIGLELQFSIPRLRQIGPGESCPDGVTYSISGRIDATVVRIGTFCSN
GTVSRIKMQEGVKMALHLPWFHPRNVSGFSIANRSSIKRLCIIESVFEGEGSATLMSANY
PEGFPEDELMTWQFVIPAHLRASVSFLNFNLSNCERKEERVEYYIPGSTTNPEVFKLEDK
QPGNMAGNFNLSLQGCDQDAQNPGILRLQFQVLVQHPQNESNKIYVVDLSNERATSLTIE
PRPVKQSRKFVPGCFVCLESRTCSTNLTLTSGSKHKISFLCDNLTRLWMNVEKNISCTDH
RYCQRKSYSLQVPSDILHLPVELHDFSWKLLVPKDRLSLVLVPAQKLQQHTHEKPCNTSF
SYLVASAIPSQDLYFGSFCPGGSIEQIQVKQNISVTLRTFAPSFRQEASRQGLTVSFIPY
FKEEGVFTVTPDTKSKVYLRTPNWDRGLPSLTSVSWNISVPRDQVACLTFFKERTGVVCQ
TGRAFMIIQEQRTRAEEIFSLDEDALPKPRFHHHSFWVNISNCSPASGKQLDLLFWVTLT
PRTVDLTVILITVVGGGALLLSALGLIICCVKKKKKKTNKGPAVGVYNGNINTEMPRQPK
KFQKGRKDNDSHVYAVIEDTMVYGHLLQDSGGSFLQPEVDTYRPFQGTMGVCPPSPPTIC
SRAPTAKFAAEELPPCSPPESESEPYTFSHPNNGDVNSKDTDIPLLNTQEPVEPAE
Download sequence
Identical sequences A0A096MW26
ENSPANP00000004067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]