SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004108 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004108
Domain Number 1 Region: 84-196
Classification Level Classification E-value
Superfamily TPR-like 2.91e-37
Family Tetratricopeptide repeat (TPR) 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004108   Gene: ENSPANG00000018405   Transcript: ENSPANT00000000638
Sequence length 304
Comment pep:known_by_projection chromosome:PapAnu2.0:6:61482793:61540862:-1 gene:ENSPANG00000018405 transcript:ENSPANT00000000638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSIKHLVYAVIRFLREQSQMDTYTSDEQESLEVAIQCLETVFKISPEDTHLAVSQPLTE
MFTNSFCKNDVLPLSNSVPEDVGKADQLKDEGNNHMKEENYAAAVDCYTQAIELDSNNAV
YYCNRAAAQSKLGHYTDAIKDCEKAIAIDSKYSKAYGRMGLALTAMNKFEEAVTSYQKAL
DLDPENDSYKSNLKIAEQKLREVSSPTGTGLSFDMASLINNPAFISMAASLMQNPQVQQL
MSGMMTNAIGGPAAGVGGLTDLSSLIQAGQQFAQQIQQQNPELIEQLRNHIRSRSFSSSA
EEHS
Download sequence
Identical sequences A0A096MW67 A0A0D9RTS3 A0A2K5HA08 A0A2K5MND5 A0A2K5YJR7 A0A2K6E7S7 A0A2K6L969 A0A2K6PXA3 G7MU68
ENSPANP00000004108 XP_007972137.1.81039 XP_007972138.1.81039 XP_007972139.1.81039 XP_010366012.1.97406 XP_011770374.1.29376 XP_011770375.1.29376 XP_011770376.1.29376 XP_011816688.1.43180 XP_011822136.1.47321 XP_011941441.1.92194 XP_011941442.1.92194 XP_011941443.1.92194 XP_014995613.1.72884 XP_014995615.1.72884 XP_014995616.1.72884 XP_017732595.1.44346 XP_017732596.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]