SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004118 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004118
Domain Number 1 Region: 50-178
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 2.62e-58
Family N-terminal domain of cbl (N-cbl) 0.000000168
Further Details:      
 
Domain Number 2 Region: 265-351
Classification Level Classification E-value
Superfamily SH2 domain 2.49e-48
Family SH2 domain 0.00000221
Further Details:      
 
Domain Number 3 Region: 357-435
Classification Level Classification E-value
Superfamily RING/U-box 7.27e-43
Family RING finger domain, C3HC4 0.00000878
Further Details:      
 
Domain Number 4 Region: 179-264
Classification Level Classification E-value
Superfamily EF-hand 7.48e-38
Family EF-hand modules in multidomain proteins 0.00000519
Further Details:      
 
Domain Number 5 Region: 842-894
Classification Level Classification E-value
Superfamily UBA-like 0.00000901
Family UBA domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004118   Gene: ENSPANG00000018962   Transcript: ENSPANT00000003191
Sequence length 907
Comment pep:known_by_projection chromosome:PapAnu2.0:14:108546960:108644860:1 gene:ENSPANG00000018962 transcript:ENSPANT00000003191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGNVKKSSGAGGGGGSGGSGSGGLIGLMKDAFQPHHHHHHHHLSPHPPGTVDKKMVEKC
WKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFM
ENLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTF
RITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVF
EFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTR
LGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQD
HIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFC
RCEIKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYDDDDDERADDTLFMMKELAGAKVE
RPPSPFSMAPQASLPPVPPRLDLLPQRVCVPSSASALGTASKAASGSLHKDKPLPVPPTL
RDLPPPPPPDRPYSVGTESRPQRRPLPCTPGDCPSRDKLPPVPSSRLGDSWLPRPIPKVP
VSAPSSSDPWTGRELTNRHSLPFSLPSQMEPRPDVPRLGSTFSLDTSTSMNSSPLVGPEC
DHPKIKPSSSANAIYSLAARPLPVPKLPPGEQCEGEEDTEYMTPSSRPLRPLDTSQSSRA
CDCDQQIDTCTYEAMYNIQSQAPSVTESSTFGEGSLAAAHANTGPEEPENEDDGYDVPKP
PVPAVLARRTLSDISNASSSFGWLSLDGDPTTNVTEGSQVPERPPKPFPRRINSERKAGS
WQQGSGAAASAATASPQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFVSIS
SPAHVAT
Download sequence
Identical sequences ENSPANP00000004118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]