SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004120 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004120
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily Globin-like 7.23e-55
Family Globins 0.000000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004120   Gene: ENSPANG00000004952   Transcript: ENSPANT00000003438
Sequence length 147
Comment pep:known chromosome:PapAnu2.0:14:60046720:60049465:1 gene:ENSPANG00000004952 transcript:ENSPANT00000003438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHLTPEEKNAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFDSFGDLSSPAAVMGNPK
VKAHGKKVLGAFSDGLNHLDNLKGTFAQLSELHCDKLHVDPENFKLLGNVLVCVLAHHFG
KEFTPQVQAAYQKVVAGVANALAHKYH
Download sequence
Identical sequences A0A1K0H3P4 Q9TSP1
ENSPANP00000004120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]