SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004156 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004156
Domain Number 1 Region: 5-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.49e-76
Family BAR domain 0.0022
Further Details:      
 
Domain Number 2 Region: 397-574
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0000012
Further Details:      
 
Domain Number 3 Region: 263-370
Classification Level Classification E-value
Superfamily PH domain-like 4.31e-16
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 4 Region: 818-873
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000525
Family SH3-domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004156   Gene: ENSPANG00000015327   Transcript: ENSPANT00000027385
Sequence length 874
Comment pep:known_by_projection chromosome:PapAnu2.0:14:90321831:90629024:1 gene:ENSPANG00000015327 transcript:ENSPANT00000027385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPTLEFSDSYLDSPDFRERLQCHEIELERTNKFIKELIKDGSLLIGALRNLSMAVQKF
SQSLQDFQFECIGDAETDDEISIAQSLKEFARLLIAVEEERRRLIQNANDVLIAPLEKFR
KEQIGAAKDGKKKFDKESEKYYSILEKHLNLSAKKKESHLQEADTQIDREHQNFYEASLE
YVFKIQEVQEKKKFEFVEPLLSFLQGLFTFYHEGYELAQEFAPYKQQLQFNLQNTRNNFE
STRQEVERLMQRMKSANQDYRPPSQWTMEGYLYVQEKRPLGFTWIKHYCTYDKGSKTFTM
SVSEMKSSGKMNGLVTSSPEMFKLKSCIRRKTDSIDKRFCFDIEVVERHGIITLQAFSEA
NRKLWLEAMDGKEPIYTLPAIISKKEEMYLNEAGFNFVRKCIQAVETRGITILGLYRIGG
VNSKVQKLMNTIFSPKSPPDIDIDIELWDNKTITSGLKNYLRCLAEPLMTYKLHKDFIIA
VKSDDQNYRVEAVHALVHKLPEKNREMLDILIKHLVKVSLHSQQNLMTVSNLGVIFGPTL
MRAQEETVAAMMNIKFQNIVVEILIEHYEKIFHTAPDPSIPLPQPQSRSGSRRTRAICLS
TGSRKPRGRYTPCLAEPDSDSYSSSPDSTPMGSIESLSSHSSEQNSTTKSASCQPREKSG
GIPWIATPSSSNGQKSLGLWTTSPESSSREDATKTDAESDCQSVASVTGPGDVSPPIDLV
KKGPYGLSGLKRASAASLRSISAAEGNKSYSGSIQSLTSVGSKETPKTSPNPDLPPKMCR
RLRLDTASSNGYQRPGSVVAAKAQLFENVGSPKLVSSGRQAKAMYSCKAEHSHELSFPQG
AIFSNVYPSVEPGWLKATYEGKTGLVPENYVVFL
Download sequence
Identical sequences A0A096MWA0
ENSPANP00000004156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]