SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004187 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004187
Domain Number 1 Region: 172-501
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.49e-93
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000138
Further Details:      
 
Domain Number 2 Region: 26-151
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.13e-32
Family Anticodon-binding domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004187   Gene: ENSPANG00000008858   Transcript: ENSPANT00000019838
Sequence length 502
Comment pep:known_by_projection chromosome:PapAnu2.0:13:107056534:107137069:1 gene:ENSPANG00000008858 transcript:ENSPANT00000019838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSASASRKSQEKPREIMDAAEDYAKERYGISSMIQSQEKPDRVLVRVRDLTIQKADEVV
WVRARVHTSRAKGKQCFLVLRQQQFNVQALVAVGDHASKQMVKFAANINKESIVDVEGVV
RKVNQKIGSCTQQDVELHVQKIYVISLAEPRLPLQLDDAVRPEAEGEEEGRATVNQDTRL
DNRVIDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTVSYF
KNNAYLAQSPQLYKQMCICADFEKVFCIGPVFRAEDSNTHRHLTEFVGLDIEMAFNYHYH
EVMEEIADTMVQIFKGLQERFQTEIQTVNKQFPCEPFKFLEPTLRLEYCEALAMLREAGV
EMGDEDDLSTPNEKLLGHLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNSYDMFM
RGEEILSGAQRIHDPQLLTERALHHGIVDLEKIKAYIDSFRFGAPPHAGGGIGLERVTML
FLGLHNVRQTSMFPRDPKRLTP
Download sequence
Identical sequences ENSPANP00000004187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]