SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004224 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004224
Domain Number 1 Region: 556-811
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.27e-84
Family Eukaryotic proteases 0.00015
Further Details:      
 
Domain Number 2 Region: 4-295
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.57e-70
Family Eukaryotic proteases 0.0005
Further Details:      
 
Domain Number 3 Region: 418-529
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-24
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 4 Region: 852-946
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000209
Family Spermadhesin, CUB domain 0.0088
Further Details:      
 
Domain Number 5 Region: 333-410
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000301
Family Spermadhesin, CUB domain 0.0049
Further Details:      
 
Domain Number 6 Region: 999-1052
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000811
Family Spermadhesin, CUB domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004224   Gene: ENSPANG00000019707   Transcript: ENSPANT00000020361
Sequence length 1054
Comment pep:known_by_projection chromosome:PapAnu2.0:11:28884862:28939773:-1 gene:ENSPANG00000019707 transcript:ENSPANT00000020361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVLASVGLLLLLVIGHPRSLGLKCGIRMVNVKSKEPAVGSRFFSRISSWRNSTVAGHPW
QVSLKSHEHHFCGGSLIQGDRVVTAAHCLDSLSEKQLKNIIVTSGEYSLSQKDEQEQNIP
VSKIITHPEYNIHEYMSPDIALLYLKHKVKFGTAVQPICLPDSDDKVESGVICLSSGWGK
ISKTSEYSNVLQEMELPIMDDRACNIVLKSMNLPPLGRTMLCAGFPDGAVNACQRDSGGP
LVCRRSGGIWILAGITSWVVGCAGDSAPLRNNHTKASLVIFSKVSELMDFITQNLFTGLD
QGQPISKVGPRYITKALSSVQEVNGSQRGEGILDMEKQVGCDHDYVSLQSSNGVLISNRD
LMEDDGKQNKHVCGNILPSPLLTETGETMVPFVSDTEDGGYGFELTFTAIQNSEAGSGCG
SVAILVEGTNHSAKYPDLYPSNVRCHQFIRAPEKHIIKLTFEDLTVKLSPNCIYDAVVIY
GDSEEKHKFAKLCGMLTITSIFSASNMMVIYFKSDGKNHLQGFKARFTILPSESLNKIEP
TLPPQNNPVSTIKAILHDVCGIPPFSPQWLSRRIAGGEEACPHCWPWQVGLRFLGDYQCG
GAIINPVWILTAAHCVQSKNNPLSWTIIAGDHDRNLKESTEQVRRAKHIMAHEDFNTLSY
DSDIALIQLSSPLEYSSAVRPVCLPHSTEPPFSSEICAVTGWGSISGDGGLASRLQQIQV
HVLEREVCEHTYYSAHPGGITEKMICAGFAASGEKDFCQGDSGGPLVCRHENGPFVLYGI
VSWGAGCVQPWKPGIFARVMVFLDWIQSKINGPASLQTNNTCKTLKQQLLPPTPSPGSAS
WTGCCSEAELEKPRGFYPTPRYPLDYRGRLECSWVLRVSPSSMAKFTVEYLSLLGSPVCQ
DSVLIIYEERHSKRKMAGGLHGRRLYSMTFMSPGPLVRLTFQSFVQGAFGISYIVLKVLG
PKDSKITRLSQSSNREHLVPCEDILLIKPEGITQIPRNSHRTTMSCQWRLVAPLNHIIQL
NIINFPMKPTTLVCHGHLHVYKGFGPGKKLIGNW
Download sequence
Identical sequences ENSPANP00000004224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]