SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004239 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004239
Domain Number 1 Region: 483-605
Classification Level Classification E-value
Superfamily PH domain-like 1.43e-22
Family Pleckstrin-homology domain (PH domain) 0.00000159
Further Details:      
 
Domain Number 2 Region: 367-478
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000278
Family Synaptotagmin-like (S variant) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004239   Gene: ENSPANG00000016310   Transcript: ENSPANT00000008580
Sequence length 677
Comment pep:known_by_projection chromosome:PapAnu2.0:3:144610800:145014834:-1 gene:ENSPANG00000016310 transcript:ENSPANT00000008580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDPSSSEEESDEGLEEESRDVLVAAGGSQRAPPAPTREGRRDAPGRAGGGGGAARSVSP
SPSVLSEGRDEPERQLDDEQERRIRLQLYVFVVRCIAYPFNAKQPTDMARRQQKLNKQQL
QLLKERFQAFLNGETQIVADEAFCNAVRSYYEVFLKSDRVARMVQSGGCSANDFREVFKK
NIEKRVRSLPEIDGLSKETVLSSWIAKYDAIYRGEEDLCKQPNRMTLSAVSELILSKEQL
YEMFQQILGIKKLEHQLLYNACQLDNADEQAAQIRRELDGRLQLADKMAKERKFPKFIAK
DMENMYIEELRSSVNLLMANLESLPVSKGGPEFKLQKLKRSQNSAFLDIGDENEIQLSKS
DVVLSFTLEIVIMEVQGLKSVAPNRIVYCTMEVEGEKLQTDQAEASRPQWGTQGDFTTTH
PRPVVKVKLFTESTGVLALEDKELGRVILYPTSNSSKSAELHQMVVPKNSQDSDLKIKLA
VRMDKPAHMKHSGYLYALGQKVWKRWKKRYFVLVQVSQYTFAMCSYREKKSEPQELMQLE
GYTVDYTDPHPGLQGGRMFFNAVKEGDTVIFASDDEQDRILWVQAMYRATGQSYKPVPAI
QTQKLNPKGGTLHADAQLYADRFQKHGMDEFISANPCKLDHAFLFRILQRQTLDHRLNDS
YSCLVSTSLYLVPYKLE
Download sequence
Identical sequences ENSPANP00000004239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]