SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004252 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004252
Domain Number 1 Region: 20-213
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000012
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 
Domain Number 2 Region: 158-223,253-275,311-357,407-457
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000135
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 
Domain Number 3 Region: 426-525
Classification Level Classification E-value
Superfamily TPR-like 0.000000493
Family Tetratricopeptide repeat (TPR) 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004252   Gene: ENSPANG00000010360   Transcript: ENSPANT00000001585
Sequence length 665
Comment pep:known_by_projection chromosome:PapAnu2.0:12:39455738:39457735:-1 gene:ENSPANG00000010360 transcript:ENSPANT00000001585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVLSGAQIPDGEFTVVVYRLIRDARYAEAVQLLGREPQQSPRTRAVLSLLGYCYYRLQE
FALAAECYEQLGQLHPELEQYRLYQAQALYKACLYPEATRVAFLLLDNPAYHSRVLRLQA
AIKYSEGDLPGSRSLVEQLLSGEEGEESGGENETDGQVSLGCLLYREGQYEAACSKFFAA
LQASGYQPDLSYNLALAYYSSRQYASALKHIAEIIERGIRQHPELGVGMTTEGFDVRSVG
NTLVLHQTALVEAFNLKAAIEYQLRNYEAAQEALTDMPPRAEEELDPVTLHNQALMNMDA
RPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLTYKFLTPYLYE
FLDAVITCQTAPEEAFIKLDGLAGMLTEVLRKLTIQVREARHNRDDEAIKKAVNEYDETM
EKYIPVLMTQAKIYWNLENYPMVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIG
FYEPIVKKHYDNILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYDNPNRKM
YHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYNKKLGTDTWYYAKRCFLSLLENMSKH
TIMLRDSVIQECVQFLEHCELHGRNIPAVIEQPLEEERMHVGKNTVTDESRQLKALIYEI
IGWNI
Download sequence
Identical sequences A0A096MWJ6
ENSPANP00000004252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]