SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004272 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004272
Domain Number 1 Region: 95-290
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.67e-60
Family Astacin 0.0000629
Further Details:      
 
Domain Number 2 Region: 723-830
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-38
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 3 Region: 412-516
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-37
Family Spermadhesin, CUB domain 0.0002
Further Details:      
 
Domain Number 4 Region: 563-673
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.24e-36
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 5 Region: 854-947
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-27
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 6 Region: 293-405
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.16e-27
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 7 Region: 674-716
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000782
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 8 Region: 519-561
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000949
Family EGF-type module 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004272   Gene: ENSPANG00000019718   Transcript: ENSPANT00000024103
Sequence length 958
Comment pep:known_by_projection chromosome:PapAnu2.0:5:155382861:155537518:1 gene:ENSPANG00000019718 transcript:ENSPANT00000024103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVFWGDIALDDEDLSIFQIDRTIDLTQNPFGNLGHTTGGLGDHAMSKKRGALYQLIDRIR
RIGFGLEQNNTVKGKVPLQFSGQNEKNRVPRAATSRTERIWPGGVIPYVIAGNFTGSQRA
MFKQAMRHWEKHTCVTFIERSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFG
IVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSI
MHYARNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPACGETLQES
NGNLSSPGFPNGYPSYTHCIWRVSVTPGEKIFVIFTVETLNETFIIWFHIMYIRDKFICR
KSFLLGRFCGDKVPEVLTSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEIRKNEGQIQS
PNYPDDYRPMKECVWKITVSESYHVGLTFQSFEIERHDNCAYDYLEVRDGTSENSPLIGR
FCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLG
SYQCACEPGYELGPDRRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYR
ISVKFEFFELEGNEVCKYDYVEIWSGLSSESKLHGKFCGAEVPEVITSQFNNMRIEFKSD
NTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYMCQCRNGFVLHENKHDCKEAECE
QKIHSPSGLITSPNWPDKYPSRKECTWEISATPGHRIKLAFSEFEIEQHQECAYDHLEVF
DGETEKSPILGRLCGNKIPDPLVATGNKMFVRFVSDASVQRKGFQATHSTECGGRLKAES
KPRDLYSHAQFGDNNYPGQVDCEWLLVSERGSRLELSFQTFEVEEEADCGYDYVELFDGL
DSTAVGLGRFCGSGPPEEIYSIGDAVLIHFHTDDTINKKGFHIRYKSIRYPDTTHTKK
Download sequence
Identical sequences ENSPANP00000004272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]