SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004287 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004287
Domain Number 1 Region: 106-131,175-252
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000000000696
Family Glutathione S-transferase (GST), C-terminal domain 0.02
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000004287
Domain Number - Region: 42-119
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00174
Family Glutathione S-transferase (GST), N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004287   Gene: ENSPANG00000013333   Transcript: ENSPANT00000017246
Sequence length 263
Comment pep:known_by_projection chromosome:PapAnu2.0:12:38200884:38269979:1 gene:ENSPANG00000013333 transcript:ENSPANT00000017246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLVAEAFVSQIAAAEPWPENATLYQQLKGEQILLSDNAASLAVQAFLQMCNLPIKVVCR
ANAEYMSPSGKVPFIHVGNQVVSELGPIVQFVKAKGHSLSDGLGEVQKAEMKAYMELVNN
MLLTAELYLQWCDEATVGEITHARYGSPYPWPLNHILAYQKQWEVKRKMKAIGWGKKTLD
QVLEDVDQCCQALSQRLGTQPYFFNKQPTELDALVFGHLYTILTTQLTNDELSEKVKNYS
NLLAFCRRIEQHYFEDRGKGRLS
Download sequence
Identical sequences A0A0D9RPK1 A0A2K5IMT4 A0A2K5N959 A0A2K5XBI8 A0A2K6C2N4 F6SQV9 G7PKW8
NP_001248051.1.72884 XP_005573620.1.63531 XP_007963628.1.81039 XP_011742178.1.29376 XP_011799410.1.43180 XP_011847238.1.47321 XP_011902472.1.92194 9544.ENSMMUP00000013319 ENSMMUP00000013319 ENSMMUP00000013319 ENSPANP00000004287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]