SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004288 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004288
Domain Number 1 Region: 4-265
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.12e-57
Family FCH domain 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000004288
Domain Number - Region: 738-871
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.000536
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004288   Gene: ENSPANG00000014043   Transcript: ENSPANT00000026644
Sequence length 893
Comment pep:known_by_projection chromosome:PapAnu2.0:6:67024580:67147992:1 gene:ENSPANG00000014043 transcript:ENSPANT00000026644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFIFSSHFYGEKNSGFDVLYHNMKHGQISTKELADFVRERATIEEAYSRSMTKLAKSASN
YSQLGTFAPVWDVFKTSTEKLANCHLDLVRKLQELIKEVQKYGEEQVKSHKKTKEEVAGT
LEAVQTIQSITQALQKSKENYNAKCVEQERLKKEGATQREIEKAAVKSKKATDTYKLYVE
KYALAKADFEQKMTETAQKFQDIEETHLIHIKEIIGSLSNAIKEIHLQIGQVHEEFINNM
ANTTVESLIQKFAESKGTGKERPAGLIEFEECDTASAVEGIKPRKRKTFALPGIIKKEKD
AESVAKVWYLEWGQKNIPDVDEEGYSIKPETNQNDILSSSGYSSSDSDSEDEEPKKYRIE
IKPMHPNNSHHTMASLDELKVSIGNITLSPAISVQMNRNLSIDEELTKSKPSAPPNEIGC
CVKGTSDLLAWDPLFGPSLDSSSSSLTSSSSKGFNASQAVYFCSYSSDLTEQSRNFTSFL
TDFPGCVIIEHLLETRFSFSPQPARPTTPLSVGTIVPPPRPASRPKLTSGKLSGINEISS
GFFEPRPFSPPVTSNTSPPPAAPLARAESSSSISSSASLSAANTPTVAGNMLISYLREYN
FNKRVFLGVSRGPSPVSLGNQDTLPVAVALTESVNAYFKGADPTKCIVKITGDMTMSFPS
GIIKVFTSNPTPAVLCFRVKNISRLEQILPNAQLVFRCSDPSQCDSNTKDFWMNMQAVTV
YLKKLSEQNPAASYYNIDVLKYQVSSNGIQSTPLNLATYWKCSASTTDLRVDYKYNPEAM
VAPSVLSNIQVVVPVDGGVTNMQSLPPAIWNAEQMKAFWKLSSISEKSENGGSGSLRAKF
DLSEGPSKPMTLAVQFLSEGSTLSGVDFELIGTGYRLSLIKKRFATGRYLADC
Download sequence
Identical sequences ENSPANP00000004288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]