SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004309 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004309
Domain Number 1 Region: 499-737
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000000129
Family Protein kinases, catalytic subunit 0.01
Further Details:      
 
Domain Number 2 Region: 44-71
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000222
Family CCCH zinc finger 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004309   Gene: ENSPANG00000001988   Transcript: ENSPANT00000011211
Sequence length 884
Comment pep:known_by_projection chromosome:PapAnu2.0:17:7384730:7540591:1 gene:ENSPANG00000001988 transcript:ENSPANT00000011211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSGGGLPPPSAAASPSSSSLAAAVAVVAPPGVGGVPGGAAVGVKLKYCRYYAKDKTCFY
GEECQFLHEDPAAGAAPGLGLHSNSVPLALAGAPVAGFPPGAVPGGGAGPPPGPKKPDLG
DPGTGAAAGGGGSSGGLDGPRLAIPGMDGGALTDTSLTDSYFSTSFIGVNGFGSPVETKY
PLMQRMTNSSSSPSLLNDSAKPYSGHDPLTSPASSLFNDFGALNISQRRKPRKYRLGMLE
ERLVPMGSKARKAKNPIGCLADRCKSGVPINMVWWNRVTENNLQTPNPTASEFIPKGGST
SRLSNVSQSNMSAFSQVFSHPSMGSPATAGLAPGMSLSAGSYPLHSPKITPHTSPAPRRR
SHTPNPASYMVPSSASTSVNNPVSQTPSSGQVIQKETVGGTTYFYTDTTPAPLTGMVFPN
YHIYPPTAPHVAYMQPKANAPSFFMADELRQELINRHLITMAQIDQADMPAVPTEVDSYH
SLFPLEPLPPPNRIQKSSNFGYITSCYKAVNSKDDLPYCLRRIHGFRLVNTKCMVLVDMW
KKIQHSNIVTLREVFTTKAFAEPSLVFAYDFHAGGETMMSRHFNDPNADAYFTKRKWGQH
DGPLPRQHAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKILITGKTRLRVNCVG
VFDVLTFDNSQNNNPLALMAQYQQADLISLGKVVLALACNSLAGIQRENLQKAMELVTIN
YSSDLKNLILYLLTDQNRMRSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRL
FRLLAKLGTINERPEFQKDPTWSETGDRYLLKLFRDHLFHQVTEAGAPWIDLSHIISCLN
KLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAAN
Download sequence
Identical sequences ENSPANP00000004309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]