SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004313 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004313
Domain Number 1 Region: 30-158
Classification Level Classification E-value
Superfamily TPR-like 5.26e-17
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 
Domain Number 2 Region: 246-283,347-452
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000031
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004313   Gene: ENSPANG00000020525   Transcript: ENSPANT00000023976
Sequence length 825
Comment pep:known_by_projection chromosome:PapAnu2.0:5:129711132:129766515:1 gene:ENSPANG00000020525 transcript:ENSPANT00000023976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCYEHKQYRNGLKFCKQILSNPKFAEHGEIETLAMKGLTLNCLGKKEEAYELVRRGLRND
LKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLLQIQMRDLEGYRET
RYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKTQQTSPDKVDYEYSELLLYQ
NQVLREAGLYREALEHLCTYEKQICDKLAVEETKGERKMQQRVKDARDFKRTFEEKXGQK
WRYILKNNYVLKSAANMLERLKIYEEAWTKYPRGLVPRRLPLNFLSGEKFKECLDKFLRM
NFSKGCPPVFNTLRSLYKDKEKVAIIEELVVGYETSLKSCRLFNPNDDGKEEPPTTLLWV
QYYLAQHYDKIGQPAIALEYINTAIESTPTLIELFLVKAKIYKHAGNIKEAARWMDEAQA
LDTADRFINSKCAKYMLKANLIKEAEEMCSKFTREGTSAVENLNEMQCMWFQTECAQAYK
AMNKFGEALKKCHEIERHFIEITDDQFDFHTYCMRKITLRSYVDLLKLEDVLRQHPFYFK
AARIAIEIYLKLHDNPLTDENKEHEADTANMSDKELKKLRNKQRRAKDDDDEEIGGPKEE
LIPEKLAKVETPLEEAIKFLTPLKNLVKNKIETHLFAFEIYFRKEKFLLMLQSVKRAFAI
DSSHPWLHECMIRLFSTAVCESKDLPDTVRTVLKQEMNRLFGATNPKNFNETFLKRNSDS
LPHRLSAAKMVYYLDPSSQKRAIELATTLDESLTNRNLQTCMEVLEALCDGSLGDCKEAA
EVYRANCHKLFPYALAFMPPGYEEDMKITVNGDSSAEAEELANEI
Download sequence
Identical sequences ENSPANP00000004313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]