SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004314 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004314
Domain Number 1 Region: 30-348
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.63e-112
Family Bee venom hyaluronidase 0.0000137
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000004314
Domain Number - Region: 389-408
Classification Level Classification E-value
Superfamily EGF/Laminin 0.027
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004314   Gene: ENSPANG00000019037   Transcript: ENSPANT00000007751
Sequence length 417
Comment pep:known_by_projection chromosome:PapAnu2.0:2:85005188:85007857:1 gene:ENSPANG00000019037 transcript:ENSPANT00000007751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMQLGPALVLGVALCLGCGQPLPQVPEHPFSVLWNVPSAHCKARFGVHLPLNALGIIAN
RDQHFHGQNMTIFYKNQLGLYPYFGPRGTAHNGGIPQALPLHRHLALAAYQIHHSLRPSF
AGPAVLDWEEWCPLWAGNWGRRRAYQAASWAWAQQVFPDLDPQEQLYKAYIGFEQAARAL
MEDTLRMGQALRPHGLWGFYRYPACGNGWHSMASNYTGHCHAATLARNTQLHWLWAASSA
LFPSIYLPPRLPPAHHQAFVRHRLEEAFRVALVGHRHPLPVLAYVRLTHRRSGRFLSQDD
LVQTIGVSAALGAAGVVLWGDLSLSSSEEECWHLHDYLVDTLGPYVINVTRAAMACSHQR
CHGHGRCARRDPGQMEAFLHLWPDGSLGDWKSFSCHCYCGWAGPTCQEPRLGPKEAI
Download sequence
Identical sequences A0A096MWQ6
ENSPANP00000004314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]