SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004321 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004321
Domain Number 1 Region: 44-809
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.19e-277
Family Motor proteins 0.000000000181
Further Details:      
 
Domain Number 2 Region: 1992-2066
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000439
Family Third domain of FERM 0.02
Further Details:      
 
Domain Number 3 Region: 1194-1296
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000176
Family Ubiquitin-related 0.048
Further Details:      
 
Domain Number 4 Region: 1288-1382
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000155
Family Second domain of FERM 0.0065
Further Details:      
 
Domain Number 5 Region: 1798-1871
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000134
Family Ras-binding domain, RBD 0.029
Further Details:      
 
Domain Number 6 Region: 1496-1578
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000827
Family SH3-domain 0.002
Further Details:      
 
Domain Number 7 Region: 816-879
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000354
Family Motor proteins 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004321   Gene: ENSPANG00000010543   Transcript: ENSPANT00000021666
Sequence length 2085
Comment pep:known_by_projection chromosome:PapAnu2.0:13:124762151:124864490:1 gene:ENSPANG00000010543 transcript:ENSPANT00000021666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGFRLGDHVWLEPPSTHKTGVAIGGIIKETKPGKILVEDDEGKEHWIRAEDFGVLSPMH
PNSVQGVDDMIRLGDLNEAGMVHNLLIRYQQHKIYTYTGSILVAVNPFQVLPLYTLEQVQ
LYYSRHMGELPPHVFAIANNCYLNMKRNKRDQCCIISGESGAGKTETTKLILQFMATVSG
QHSWIEQQVLEANPILEAFGNAKTIRNDNSSRFGKYIDIYFNPSGVIEGARIEQFLLEKS
RVCRQAPEERNYHIFYCMLMGMSAEDKQLLSLGTPSEYHYLTMGNCTSCEGLNDAKDYAH
IRSAMKILHFSDSESWDLSKLLAAILHLGNVGFMASVFENLDASDVMETPAFPTVMKLLE
VQHQELRDCLTKHTILIRGEFVTRPLNIVQAADRRDAFVKGIYGHLFLWIVKKINAAIFT
PPAQDPKNVRRAIGLLDIFGFENFENNSFEQLCINFANEHLQQFFVQHVFAMEQEEYRSE
NISWDYIHYTDNRPTLDLLALKPMSVISLLDEESRFPQGTDLTMLQKLNSVHSNNKAFLQ
PKNIHDARFGIAHFAGEVYYQAEGFLEKNRDVLSTDILTVVYSSKNKFLRELFNLESAET
RLGHGTIRQAKAGNHLFKSADSNKRPSTLAGQFKQSLDQLMKILTNCQPYFIRCIKPNEY
KKPLLFDRELCLRQLRYSGMMETVRIRKSGFPIRYTFEEFSQRFGALLPSAVRMQLRGKF
RQMTLGIADMWLRTDKDWKVGKTKIFLKDHQDTLLEVQRSQVLDRAALSIQRVLRGYRYR
KEFLRQRRAAVTVQAWWRGYCNRRNFKLILVGFERLQAIARSQQLARQYQAMRQRTVQLQ
ALCRGYLVRQQVQAKRRAVVVIQAHARGMAARRNFQQRRANGMQAPLVIPAEGQKSQGAL
PAKKRKSIYDTVTDTEMVEKVFGFLPAMIGGQEGQASPRFEDLESKTQKLPEVDLDTVPM
VDEPEEDVDGLAEYTFPKFAVTYFQKSASHTHIRRPLRYPLLYHEDDADCLAALAVWNVI
LRFMGDLPEPVLYARSNQQGSSVMRQIHDTLGRGHGAQAPQHRFAQVASQLNIGEEALEP
DGLGADRPMSNLEKVHFTVGYAILRPSLRDEIYCQICKQLSENFKTSSVARGWILLSLCL
GCFPPSERFMKYLLNFIGQGPATYGPFCAERLRRTYANGVRAEPPTWLELQAVKSKKHIP
IQVILATGESLTVSVDSASTSREVCLHIAHKQGLSDHLGFSLQVAVYDKFWSLGSGRDHV
MDAIAQCEQLAQERGESQRQSPWRIYFRKEFFAPWHDSREDPVSTELIYRQVLHGVWSGE
YSFEKEEELVELLARHCYVQLGASAESQAVQELLPSCVPHRLYRTKPPDRWASLVTAACA
KKREAPGTQTRSRMPSCTERVTDPQGIGGALLFSRLFEVTTLSGPRLPKTQLILAVNWKG
LCFLDQREKTLLELSFPEVMGLVANREAQGRQRLLLSTMHEEYEFVSPSSVAIAELVALF
LEGLKERSVFAMALQDRKATDDTTLLAFKKGDLLVLTKKQGLLASENWTLGQNDRTGKTG
LVPTACLYTIPTVTKPSAQLLSLLTMSPEKRKLAAQEGQLAEPRPEEPPKEKPHTLEEFS
YEFFRAPEKDTVSMAVLPLARARGHLWAYSSEPLRQPLLKRVHANVDLWDIACQIFVATP
ILRYMGDYPSRQARPSLELTDQIFTLALQHPALQDEVYCQLLKQLTHNSNRHSEERGWQL
LWLCTGLFPPSKGLLPHAQKFIDTRRGKLLAPDCGRRIQRVLRTGPRKQPPHQVEVEAAE
QNISRICHKVYLPNDTSEMLEVVANTRVRDVCDSIATRLQLASWEGCSLFIKIADKVISQ
KEGDFFFDSLRQVSDWVKKNKPQKEGEEASVELGEGVAGWGEGAPSASVWPVPIHPSIPS
CVSLGCGDNQALGPGGEGLPAQVWGCQGVRAGAPAGPGLVPTAGPRPGAPVTLPYQVYFM
RKLWLNVTPGKDVIILIAINRHGVLLIHPKTKDLLTTYPFTKISSWSSGSTYFHMVLGNL
GRGSRLLCETSLGYKMDDLLTSYVQQLLSAMNKQWGSKAPALASA
Download sequence
Identical sequences ENSPANP00000004321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]