SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004327 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004327
Domain Number 1 Region: 1952-2106
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.37e-29
Family Ankyrin repeat 0.0000039
Further Details:      
 
Domain Number 2 Region: 1268-1400
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000267
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 544-668
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000416
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 4 Region: 1043-1084
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000949
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 5 Region: 726-856
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000369
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 915-1047
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000152
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 7 Region: 889-927
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000474
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 8 Region: 664-707
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000634
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 9 Region: 1080-1123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000711
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 10 Region: 1113-1159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000578
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 11 Region: 278-319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000108
Family EGF-type module 0.016
Further Details:      
 
Domain Number 12 Region: 1157-1196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000176
Family EGF-type module 0.0035
Further Details:      
 
Domain Number 13 Region: 392-439
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000335
Family EGF-type module 0.019
Further Details:      
 
Domain Number 14 Region: 313-352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000875
Family EGF-type module 0.0033
Further Details:      
 
Domain Number 15 Region: 418-551
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000119
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 16 Region: 197-237
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000387
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 17 Region: 354-396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000411
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 18 Region: 848-891
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000482
Family EGF-type module 0.015
Further Details:      
 
Domain Number 19 Region: 1437-1476
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000661
Family EGF-type module 0.014
Further Details:      
 
Domain Number 20 Region: 1396-1440
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000734
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 21 Region: 1556-1588
Classification Level Classification E-value
Superfamily Notch domain 0.000000085
Family Notch domain 0.0015
Further Details:      
 
Domain Number 22 Region: 1509-1547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000101
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 23 Region: 1196-1238
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000214
Family EGF-type module 0.022
Further Details:      
 
Domain Number 24 Region: 240-276
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000255
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 25 Region: 1635-1666
Classification Level Classification E-value
Superfamily Notch domain 0.000000275
Family Notch domain 0.0034
Further Details:      
 
Domain Number 26 Region: 160-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00005
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000004327
Domain Number - Region: 1598-1629
Classification Level Classification E-value
Superfamily Notch domain 0.00114
Family Notch domain 0.0084
Further Details:      
 
Domain Number - Region: 1249-1276
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00768
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004327   Gene: ENSPANG00000024009   Transcript: ENSPANT00000026596
Sequence length 2120
Comment pep:known_by_projection chromosome:PapAnu2.0:1:120717348:120870470:-1 gene:ENSPANG00000024009 transcript:ENSPANT00000026596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPAPMTRSRSLRAELGPALLPAGNPWVPKTAGPRPRRQWGGACGGRRRLRRKDTRGCFA
AHSRKFQPNFGRRLRRRRRRGGLGARGLRSVAPGPEPLKQEVGRREWGSSVGTPSPCGSA
QAAAAEEEATKKMPALRPALLWALLALWLCRAAPARALQCRDGYEPCVNEGMCVTYHNGT
GYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHP
CFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSC
KCLTGFTGQKCETDVNECDIPGHCQHGGTCLNLPGSYQCQCPQGFTGQHCDSLYVPCAPS
PCVNGGTCRQTGDFTFECNCLPGFEGSTCERNIDDCPNHRCQNGGVCVDGVNTYNCRCPP
QWTGQFCTEDVDECLLQPNACQNGGTCANRNGGYGCVCVNGWSGDDCSENIDDCAFASCT
PGSTCIDRVASFSCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYK
GADCTEDVDECAMANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQND
ATCLDKIGGFTCLCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPV
CQIDIDDCSSTPCLNGAKCIDHPNGYECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGI
DSYTCICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGVNCEINFDD
CASNPCIHGICMDGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINGVNGFRCIC
PEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCEVDKNECLSNPCQN
GGTCDNLVNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGK
NCQTVLAPCSPNPCENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDECISKPCMNHGLC
HNTQGSYMCECPPGFSGMDCEEDIDDCLANPCQNGGSCVDGVNSFSCLCLPGFTGDKCQT
DMNECLSEPCKNGGTCSDYVNSYTCKCQAGFDGVHCENNIDECTESSCFNGGTCVDGINS
FSCLCPVGFTGLFCLHEINECSSHPCLNEGTCVDGLGTYHCSCPLGYTGKNCQTLVNLCS
RSPCKNKGTCIQDKAESRCRCPSGWAGAYCDVPNVSCDIAASRRGVLVEHLCQHSGVCIN
AGNTHYCQCPLGYTGSYCEEQLDECASNPCQHGATCSDFIGGYRCECVPGYQGVNCEYEV
DECQNQPCQNGGTCIDLVNHFKCSCPPGTRGLLCEENIDDCARGPHCLNGGQCVDRIGGY
GCRCLPGFAGERCEGDINECLSNPCSSEGSLDCIQLTNDYLCVCRSAFTGRHCETFVDVC
PQMPCLNGGTCAVASNMPDGFICRCPPGFSGARCQSSCGQVKCRKGEQCVHTASGPRCFC
PNPRDCESGCASSPCQHGGSCHPQRQPPYYSCQCAPPFWGSRCELYTAPPSTPPATCLSQ
YCADKARDGVCDEACNSHACQWDGGDCSLTMENPWANCSSPLPCWDYINNQCDELCNTAE
CLFDNFECQGNSKTCKYDKYCADHFKDNHCDQGCNSEECGWDGLDCAADQPENLAEGTLV
IVVLMPPEQLLQDARSFLRALGTLLHTNLRIKRDSQGELMVYPYYGEKSAAMKKQRMTRR
SIPGEQEQEVAGSKVFLEIDNRQCVQDSDHCFKNTDAAAALLASHAIQGTLSYPLVSVVS
ESLTPERTQLLYLLAVAVVIILFIILLGVIMAKRKRKHGSLWLPEGFTLRRDASNHKRRE
PVGQDAVGLKNLSVQVSEANLIGSGTSEHWVDDEGPQPKKVKAEDEALLSEEDDPIDRRP
WTQQHLEAADIRRTPSLALTPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDLSDED
EDAEDSSANIITDLVYQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDN
MGRCPLHAAVAADAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELINCQA
DVNAVDDHGKICPSLGSCCQ
Download sequence
Identical sequences ENSPANP00000004327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]