SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004340 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000004340
Domain Number - Region: 13-120
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00863
Family Apolipoprotein A-I 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004340   Gene: ENSPANG00000024158   Transcript: ENSPANT00000009345
Sequence length 184
Comment pep:known_by_projection chromosome:PapAnu2.0:8:89156250:89162742:1 gene:ENSPANG00000024158 transcript:ENSPANT00000009345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMRRTLENRNAQTKQLQTAVSNVEKHFGELCQIFAAYVRKTARLRDKADLLVNEINAYAA
TETPHLKLGLMNFADEFAKLQDYRQAEVERLEAKVVEPLKAYGTIVKMKRDDLKATFTAR
NREAKQLTQLERTRQRNPSDRHVIVSFEFGSLKKCLRLLLPSSARNHMRSGSLRAFEVPE
HLHS
Download sequence
Identical sequences A0A2K6LAD2
ENSPANP00000004340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]