SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004354 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004354
Domain Number 1 Region: 96-363
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.81e-56
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 50-112
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000373
Family Complement control module/SCR domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004354   Gene: ENSPANG00000009861   Transcript: ENSPANT00000013020
Sequence length 364
Comment pep:novel chromosome:PapAnu2.0:20:54482076:54485127:-1 gene:ENSPANG00000009861 transcript:ENSPANT00000013020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCCEAGRPAFHSFLSSLCSALGAVVALLLWGQLFAVDSGNDVTDIADDGCPKPPMIANGY
VEHLVRYQCKNYYRLRTEGDGVYTLNNEKQWTNKAVGDKLPECEAVCGKPKNPADAVQRI
LGGHLDAKGSFPWQAKMVSRHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLT
LYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVPVNERVMPICLPSKDYAEVGRVGYVS
GWGRNANFNFTDHLKYVMLPVADQYNCIKHYEGSTVPEKKTPKSPVGEQPILNEHTFCAG
MSKYQEDTCYGDAGSAFAVHDLEKDTWYAAGILSFDKSCGVAEYGVYVKATSIQDWVQKT
IAEN
Download sequence
Identical sequences ENSPANP00000004354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]