SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004384 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004384
Domain Number 1 Region: 1327-1657
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000863
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 
Domain Number 2 Region: 1744-1945
Classification Level Classification E-value
Superfamily TPR-like 0.0000247
Family Tetratricopeptide repeat (TPR) 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004384   Gene: ENSPANG00000009558   Transcript: ENSPANT00000009812
Sequence length 1966
Comment pep:known_by_projection chromosome:PapAnu2.0:11:67031028:67083812:-1 gene:ENSPANG00000009558 transcript:ENSPANT00000009812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATADTPAPASSGLSPKEEGELEDGEISDDDNNSQIRSRSSSSSSGGGLLPYPRRRPPHS
ARGGGSGGGGGSSSSSSSSQQQLRNFSRSRHASERGHLRGPSSYRPKEPFRSHPPSVRMP
SSSLSESSPRPSFWERSHLALDRFRFRGRPYRGGSRWSRGRGVGERGGKPGCRPPLGGGA
GSGFSSSQSWREPSPPRKSSKSFGRSPSRKQNYSSKNENCVEETFEDLLLKYKQIQLELE
CINKDEKLALSSKEENVQEDPKTLNFEDQTSTDNVSITKDSSKEIAPEEKTQVKTFQAFE
LKPLRQKLTLPGDKNRLKKVKDGAKPLSLKSDTTDSSQGLQDKEQNLTRRISTSDILSEK
KLGEDEEELSELQLRLLALQSASKKWQQKEQQVMKESKEKLTKTKTVQQKVKTSTKTHSA
KKVSTTAKQALRKQQTKAWKKLQQQKEQERIRDLSNQEEQYNRFMKLVGGKRRSRSKSSD
PDLRRSLDKQPTDSGGGIYQYDNYEEVAMDTDSETSSPAPSPVQPPFFSECSLGYFSPAP
SLSLPPPPQVSSLPPLSQPYVEGLCVSLEPLPPLPPLPPLPPEDPEQPPKPPFADEEEEE
EMLLREELLKSLANKRAFKPEETSSNSDPPSPPVLNNSHTVPRSNLSIVSINTVSQPRIQ
NPKFHRGPRLPRTVISLPKHKSVVVTLNDSDDSESDGEASKSTNSVFGGLESMIKEARRT
AEQASKPKVPPKSEKENDPLRTPEALPEEKKIEYRLLKEEIANREKQRLIKSDQLKTSSS
SPANSDVEIDGIGRIAMVTKQVTDAESKLKKHRILLMKDESVLKNLVQQEAKKKESVRNA
EAKITKLTEQLQATEKILNVNRMFLKKLQEQIHRVQQRVTIKKALTLKYGEELARAKAVA
SKEIGKRKLEQDRFGPNKMMRLDGSPVSSPRKHSAELIAMEKRRLQKLEYEYALKIQKLK
EARALKAKEQQNISPVVEEEPEFSLPQPSLHDLTQDKLTLDTEENDVDDEILSGSSRERR
RSFLESNYFTKPNLKHTDTANKECINKLNKNTVEKPELFLGLKIGELQKLYSKADSLKQL
ILKTTTGITEKVLHGQEISVDVDFVTAQSKTMEVKPCPFRPYHSPLLVFKSYRFSPYYRT
KEKLPLSSVSYSNMIKPDQCFCRFDLTGTCNDDDCQWQHIQDYTLSRKQLFQDILSYNLS
LIGCAETSTNEEITAAAEKYIEKLFGVNKDRMSMDQMAVLLVSNINESKGHTPPFTTYKD
KRKWKPKFWRKPISDNSFSSDEEQSTGPIKYAFQPENQINVPALDTVVTPDDVRYFTNET
DDIANLEASVLENPSHVQLWLKLAYKYLNQNEGEGSESLDSALNVLARALENNKDNPEIW
CHYLRLFSKRGTKDEVQEMCETAVEYAPDYQSFWTFLHLESTFEEKDYVCERMLEFLMGA
AKRETSSILSFQLLEALLFRVQLHIFTGRCQSALAILQNALKSANDGIVAEYLKTSDRCL
AWLAYIHLIEFNILPSKFYDPSNDNPSRIVNTESFVMPWQAVQDVKTNPDMLLAVFEDAV
KACTDESLTVEERIEACLPLYTNMIALHQLLERRYEAAMELCKSLLESCPINCQLLEALV
ALYLKTNQHDKARALWLTAFEKNPQNAEVFYHMCKFFILQVKNNVLLPFXFDWLSKFADP
KLKQHQKLDLNRYLLNIPGPIDIPSRLCKGNFEDDMFNHQVPYLWLIYCLCHPLQSSIKE
TVEAYEAALGVAMRCDIVQKIWMDYLVFANNRAAGSRNKVQEFKFFTDLVNRCLVTVPAR
YPIPFSSADYWSNYEFHNRVIFFYLSCVPKTQHSKTLERFCSIMPANSGLALRLLQHEWE
ESNVQILKLQAKMFTYNIPTCLATWKIAIAAEIVLKGQREVHRLYQRALQKLPLCASLWK
DQLLFEASEGGKTDNLRKLVSKCQEIGVSLNELLNLNSNKTESKNH
Download sequence
Identical sequences ENSPANP00000004384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]