SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004416 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004416
Domain Number 1 Region: 291-557
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.42e-79
Family Protein kinases, catalytic subunit 0.00000000139
Further Details:      
 
Domain Number 2 Region: 181-324
Classification Level Classification E-value
Superfamily SH2 domain 1.85e-37
Family SH2 domain 0.00000877
Further Details:      
 
Domain Number 3 Region: 121-206
Classification Level Classification E-value
Superfamily SH3-domain 8.28e-22
Family SH3-domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004416   Gene: ENSPANG00000024756   Transcript: ENSPANT00000010229
Sequence length 569
Comment pep:known_by_projection chromosome:PapAnu2.0:8:51971047:52057050:1 gene:ENSPANG00000024756 transcript:ENSPANT00000010229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFRLLLTLYTVTTFSRIHCILCVANIYTVIQLCRKRKTTLDFVAILFPAFWIAAGNMGC
IKSKGKDSLNDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQAKDPEE
QGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNT
LETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDFDPVHGDVIKHY
KIRSLDNGGYYISPRITFPCISDMIKHYQKQPDGLCRRLEKACISPKPQKPWDKDAWEIP
RESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHDKLV
RLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIERKNY
IHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCFTIK
SDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCWKEK
AEERPTFDYLQSVLDDFYTATEGQYQQQP
Download sequence
Identical sequences ENSPANP00000004416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]