SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004450 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004450
Domain Number 1 Region: 64-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000544
Family EGF-type module 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004450   Gene: ENSPANG00000012605   Transcript: ENSPANT00000009083
Sequence length 178
Comment pep:known_by_projection chromosome:PapAnu2.0:5:54097613:54148442:1 gene:ENSPANG00000012605 transcript:ENSPANT00000009083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRAAPGSGASSLPLLLALALGLVILHCVVADGNSTRSPETNGLLCGDPDENCAATTTQS
KQKGHFSRCPKQYKHYCIKGRCRFVVTEQTPSCVCDEGYIGARCERVDLFYLKGDRGQIL
VICLIAVMVVFIILVIGVCTCCHPLRKRHKRKKKEEEMQTLGKDITPINEDIEETNIS
Download sequence
Identical sequences A0A096MX40
ENSPANP00000004450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]