SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004458 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004458
Domain Number 1 Region: 126-201
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000176
Family Ubiquitin-related 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004458   Gene: ENSPANG00000011913   Transcript: ENSPANT00000012448
Sequence length 790
Comment pep:known_by_projection chromosome:PapAnu2.0:3:145607894:145689495:-1 gene:ENSPANG00000011913 transcript:ENSPANT00000012448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNQPKKYEAQNIANSTEESDAFDIVTIPVPSEEPQESDQTEEHESGIEQFSESHAIHVE
EQSDRSFSSLEPDNEQLMKEVISPRQVSYTPQHHEKQYAMQSPNDDSLAFLDKIKAIKES
LQESMEDSLATVKVVLIPVGQEIVISFKVDTVLKYLKDYFSHLLGIPLSVLQIRYSGKIL
RNNETLVQRGVKPQEIIQVEIFSTNPDLYPVKRIDGLTDVSQIITVTVQTGLDRYQQVAV
EIVKSDFHKPFLGGFRHKVTGVEYHHAGTQTVPKKIPERLSVFCRDTQTVFQKKNLQQTT
NTTSTQMTNIGVYVSNMTDKLVTPGKYFSAAEYHAQRLKAVIVIQTYYRQWHAKIFVEDL
RRQKSLRLEWETQQELRKIREKEEWIKLDYHRRHNPKTNEDFEFLYNALEFWRQEELKRI
NQSFTGAERKAALCELLEKETQIIASIGRHRYIAYTANEEAAIQAFLDKCSAPKIWRTPN
GKTIEMDTQFTIRARELQNIYKCIMLKNISQDERLDVLLTLKHTVKEHECKLTQEILELI
DREVDLMMRGVKHHNLEGLRKRIATLFFHYIKTPLFNPEVAKYLKVPQDPLKFYKKIYFC
HSCQLYLPSTEFSISSTSRRIYRCRNCISLENEAQKRESFLKYKCLLQQLYFTEADYEDD
SKIAFLMQLQDIQYLTENIWASQSVLSAWDDLSDLVMVRWNKSLEWSPWNCILLTKDEAA
AHLNLTSIEEGYERSFIHKIKHKHILAKNYFSQIPVLASFILDDAEIDEIRWKHHSDTTP
KIIESQRPPP
Download sequence
Identical sequences A0A096MX48
ENSPANP00000004458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]