SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004463 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000004463
Domain Number - Region: 437-531
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00558
Family IMD domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004463   Gene: ENSPANG00000007396   Transcript: ENSPANT00000007272
Sequence length 553
Comment pep:known_by_projection chromosome:PapAnu2.0:4:143892357:144049576:1 gene:ENSPANG00000007396 transcript:ENSPANT00000007272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGRFLAPEASGRDSPGGARSFPAGPDYSSAWLPGNESLWQATTLPSNHRNNHIRRHSIA
SDSGDTGIGTSCSDSVEDHSTSSGTLSFKPSQSLITLPTAHVMPSNSSASISKLRESLTP
DGSKWSTSLMQTLGNHSRGEQDSSLDMKDFRPLRKWSSLSKLTAPDNCGQGGTVCREESR
NGLEKIGRAKALTSQLRTVGPSCLHDSMEMLKLEDKEVNKKRSSTLDCKYKFESCSKEDF
RASSSTLRRQTVDMTYSALPESKPIMTSSEAFEPPKYLMLGQQAVGGVPIQPSVRTQMWL
TEQLRTNPLEGRNTEDSYSLAPWQQQQIEDFRQGSETPMQVLAGSSRQSYSPSGYQDFSK
WESMLKIKEGLLRQKEIVIDRQKQQITHLHERIRDNELRAQHAMLGHYVNCEDSYVASLQ
PQYENTSLQTPFSEESVSHSQQGEFEQKLASTEKEVLQLNEFLKQRLSLFSEEKKKLEEK
LKTRDRYISSLKKKCQKESEQNKEKQRRIETLEKYLADLPTLDDVQSQSLQLQILEEKNK
NLQEALIDTEKKN
Download sequence
Identical sequences ENSPANP00000004463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]