SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004494 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004494
Domain Number 1 Region: 101-215
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.83e-30
Family Chaperone J-domain 0.00026
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000004494
Domain Number - Region: 4-45,135-159
Classification Level Classification E-value
Superfamily TPR-like 0.0813
Family Tetratricopeptide repeat (TPR) 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004494   Gene: ENSPANG00000006557   Transcript: ENSPANT00000015210
Sequence length 376
Comment pep:known_by_projection chromosome:PapAnu2.0:5:91241965:91288561:-1 gene:ENSPANG00000006557 transcript:ENSPANT00000015210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGNRDEAEKCVEIAREALNAGNREKAQRFLQKAEKLYPLPSARALLEIIMKNGSTAGNS
PHCRKPSGSGDQNKPNGTKDSTSGSGEGGKGYTKDQVDGVLSINKCKNYYEVLGVTKDAG
DEDLKKAYRKLALKFHPDKNHAPGATDAFKKIGNAYAVLSNPEKRKQYDLTGNEEQACNH
QNNGRFNFHRGCEADITPEDLFNIFFGGGFPSGSVHSFSNGRAGYSQQHQHRHSGHEREE
ERGDGGFSVFIQLMPIIVLILVSLLSQLMVSNPPYSLYPRSGTGQTIKMQTENLGVVYYV
NKDFKNEYKGMLLQKVEKSVEEDYVTNIRNNCWKERQQKTDMQYAAKVYRDDRLRRKADA
LSMDNCKELERLTSLL
Download sequence
Identical sequences ENSPANP00000004494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]