SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004497 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004497
Domain Number 1 Region: 233-348
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.11e-33
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 2 Region: 1283-1403
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-32
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 3 Region: 70-174
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-32
Family Spermadhesin, CUB domain 0.0006
Further Details:      
 
Domain Number 4 Region: 935-1041
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.11e-31
Family Spermadhesin, CUB domain 0.00035
Further Details:      
 
Domain Number 5 Region: 1456-1576
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.14e-31
Family Spermadhesin, CUB domain 0.0008
Further Details:      
 
Domain Number 6 Region: 752-873
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-30
Family Spermadhesin, CUB domain 0.00068
Further Details:      
 
Domain Number 7 Region: 1627-1746
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-29
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 8 Region: 592-695
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-26
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 9 Region: 412-521
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-26
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 10 Region: 1108-1221
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.59e-20
Family Spermadhesin, CUB domain 0.0038
Further Details:      
 
Domain Number 11 Region: 2165-2233
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.48e-19
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 12 Region: 2222-2291
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.04e-18
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 13 Region: 2405-2473
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.28e-17
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 14 Region: 2584-2653
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.18e-17
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 15 Region: 1820-1915
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.03e-17
Family Spermadhesin, CUB domain 0.003
Further Details:      
 
Domain Number 16 Region: 2462-2532
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 17 Region: 2280-2350
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.12e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 18 Region: 2521-2580
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.61e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 19 Region: 2704-2772
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000031
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 20 Region: 1979-2047
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000005
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 21 Region: 872-932
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000111
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 22 Region: 2642-2699
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000153
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 23 Region: 179-247
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000025
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 24 Region: 697-767
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000025
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 25 Region: 9-70
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000032
Family Complement control module/SCR domain 0.00097
Further Details:      
 
Domain Number 26 Region: 2337-2399
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000473
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 27 Region: 2107-2169
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000584
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 28 Region: 1048-1112
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000973
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 29 Region: 1917-1990
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000117
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 30 Region: 354-414
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000118
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 31 Region: 1574-1643
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000153
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 32 Region: 1228-1291
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000181
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 33 Region: 1402-1466
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000162
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 34 Region: 527-587
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000418
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 35 Region: 1745-1806
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000103
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 36 Region: 2763-2820
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000445
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 37 Region: 2061-2117
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000167
Family Complement control module/SCR domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004497   Gene: ENSPANG00000022093   Transcript: ENSPANT00000009851
Sequence length 3053
Comment pep:known_by_projection chromosome:PapAnu2.0:8:2948515:3398227:-1 gene:ENSPANG00000022093 transcript:ENSPANT00000009851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSEIEKGGCGDPGIPAYGKRMGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKP
SCVFSCFFNFTASSGIILSPNYPEEYGNNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFL
AVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNECH
DPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPC
GGHLTASSGVILPPGWPGYYKDSLNCEWIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGP
ASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLDPGI
PVNGHRHGSDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIHGKS
GTVLSPGFPDFYPNSLNCTWTIEVSHGKGVQMIFHTFHLESSHDYLLITEDGSFSEPVAR
LTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSRRIG
FHFGVGDSLTFSCFPGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSP
NFPSNYDNNHECIYKIETEAGKGIHLRARSFQLFEGDTLKVYDGKDSSSRPLGTFTKNEL
LRLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHFTDT
VVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPY
DNNLHCTWIIEADPGKTISLHFIVFDTEMAHDILKVWDGPVDSDILLKEWSGSALPEDIH
STFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTITFQCD
PGYQLQGQAKITCVQLNNRFFWQPDPPTCIVAAACGGNLTGPAGVILSPNYPQPYPPGKE
CDWRVKVNPDFVIALIFKSFNMEPSYDFLHIYEGEDSNSPLIGSYQGAQAPERIESSGNS
LFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRIGTDFKLGSTITYQCDSGYKI
IDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYMGSEGVVLSPNYPHNYTAGQICLYSIT
VPKEFEGPSLVALHFIYFQTALNDLAELFDGTHAQARLLSSLSGSHSGETLPLATSNQIL
LRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYL
LQGSTALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKI
IVTEGSGIQIQVISFATEQNWDSLEIHDGGDVTAPRLGSFSGTTVPALLNSTSNQLYLHF
QSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSH
ISCMPGTVRRWNYPSPLCIATCGGTLNTLGGVILSPGFPGSYPNNLDCTWRISLPVGYGA
HIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFSGTDLPAALLSTTHETLIHFYSDHSQNR
QGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSISFECYPGYILIGHPVLTCQHGIN
RNWNYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQ
TEAVNDYIAVWDGPDQNSPQLGVFSGNTALETAYSSTNQVLLKFHSDFSNGGFFVLNFHA
FQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDTLTCKLSSQLQFEGSL
PTCEEVLPYLEVEIALGAKVSSPDEPSSYLNDKSTQHSIKVEPNYNITIVDTFQSEKQDA
LEVFDGSSGQSPLLVVLSGNHTEQSNFTSRSNQLYLRWSTDHATSKKGFKIRYAAPYCSL
THPLKNGGILNRTAGAVGSKVHYFCKPGYRMIGHSNATCRRNPLGMYQWDSLMPLCQAVS
CGIPESPGNGSFTGNEFTLDSKVVYECHEGFKLEPSQQATAVCQEDGLWSNKGKLPTCKP
VPCPSIETQLSEHVIWRLVSGSLNEYGAQVLLSCSPGYYLEGRRLAQCQANGTWNIGDER
PGCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGTETR
CLAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCV
PITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGASRAQCRSNGQWSSPLPTCRVV
NCSDPGFVENAIRHGQQNFPESFEYGMSVLYHCKKGFYLLGSSALTCMANGLWDRSLPKC
LAISCGHPGVPANAILTGELFTYGATVRYSCRGSQSLIGNDTRVCQEDSHWSGALPHCTG
NNPGFCGDPGTPAHGSRLGDEFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCE
AVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTWTGTAPDCTI
ISCGDPGTLANGIQFGTDFTFNQTVSYQCNPGYLMEPVTSATIRCTKDGTWNQSKPVCKE
KTAVLCPQPPPVQNGTVEGTDFHWGSSISYSCVDGYQLSHSAILSCEGRGVWKGEVPQCL
PVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRICQADGMWSGIQPACIDP
AHNTCPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECI
PHACRQPETPAHADVRAIDLPTFGYTLVYTCHPGFFLAGGSEHRTCKADMKWTGKSPVCK
SKGVREVNETVTKTPVPSDVFFVNSVWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSE
ASQVELRLTGVYKKEEAHLLLKAFQIKGPADIFVSKFENDNWGLDGYVSSGLERGGFTFQ
GDIHGKDFGKFKLERQDPLNPDQDSSNHYHGTSSGSVAAAILVPFFALILSGFAFYLYKH
RTRPKVQYNGYAGHENSNGQASFENPMYDTNLKPTEAKAVRFDTTLNTVCTVV
Download sequence
Identical sequences ENSPANP00000004497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]