SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004498 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004498
Domain Number 1 Region: 539-735
Classification Level Classification E-value
Superfamily PUA domain-like 6.71e-38
Family LON domain-like 0.007
Further Details:      
 
Domain Number 2 Region: 447-500
Classification Level Classification E-value
Superfamily RING/U-box 6.24e-16
Family RING finger domain, C3HC4 0.008
Further Details:      
 
Domain Number 3 Region: 202-298
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000156
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 
Domain Number 4 Region: 137-169
Classification Level Classification E-value
Superfamily RING/U-box 0.00000287
Family RING finger domain, C3HC4 0.02
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000004498
Domain Number - Region: 26-98
Classification Level Classification E-value
Superfamily TPR-like 0.000221
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004498   Gene: ENSPANG00000016950   Transcript: ENSPANT00000011957
Sequence length 756
Comment pep:known_by_projection chromosome:PapAnu2.0:13:91674675:91711972:-1 gene:ENSPANG00000016950 transcript:ENSPANT00000011957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPEPVPPPPPPQCPGCDRAEPIAQRLEEGDEAFRAGEYEMAAELFRSMLAGLAQPDRGL
CLRLGDALARAGRLPEALGAFRGAARLGALRPEELEELAGGLVRAVGLRERPLSAENPGG
EPEAPGEGGPVPAPRAPRDLLGCPRCRRLLHKPVTLPCGLTVCKRCVEPGPARPQARRVN
VVLSGLLEKCFPAECRLRRLAGQARSLQRQQQPEAALLRCDQALDLAPDDNSLLLLRAEL
YLTMKNYEQAFQDASAVCQNEPLLIKGHQVKAQALSGLGRSKEVLKQFLYCLALNPECNS
MKKEAQKVMCEVLFSATENVHENLTSSIQSRLKAEGHSHMNAQALLEERDAGSSENSSEK
SDMLGNTNSSVLYFILGLHFEEDKKALESILPTAPSAGLKRQFPDDVEDAPDLNAPGKIP
KKDSDLSPQRSPNSETEESQGLSLDVTDFECALCMRLLFEPVTTPCGHTFCLKCLERCLD
HAPHCPLCKDKLSELLASRNFNITVLAEELIFRYLPDELSDRKRIYDEEMSELSNLTRDV
PIFVCAMAFPTVPCPLHVFEPRYRLMIRRCMETGTKRFGMCLSAEHAGLSEYGCMLEIKD
VRTFPDGSSVVDAIGISRFRVLSHRHRDGYNTADIEYLEDEKVEGPEYEELAALHDSVHQ
QSVSWFASLQDRMKEQILSHFGVMPDREPEPQSMGEGLAFSWFRVIVLPLERKAQLAILG
MTSLKERLLAIRRILVIITRKMNSRQELANARERNN
Download sequence
Identical sequences ENSPANP00000004498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]