SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004504 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004504
Domain Number 1 Region: 1-74
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.69e-19
Family Ubiquitin-related 0.0000246
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000004504
Domain Number - Region: 139-169
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0336
Family PHD domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004504   Gene: ENSPANG00000022007   Transcript: ENSPANT00000016356
Sequence length 288
Comment pep:known_by_projection chromosome:PapAnu2.0:4:156941066:157592793:-1 gene:ENSPANG00000022007 transcript:ENSPANT00000016356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPTDQLRVIFAGKELRNDWTVQNCDLD
QQSIVHIVQRPWRKGQEMNATGGDNARNTAGGCEREPQSLTRVDLSSSVLPGDSVGLAVI
LHTDSRNDSLPAGSPADRPIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSC
WDDVLIPNRMSGECQSPHCPGTTAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCT
DVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCV
Download sequence
Identical sequences ENSPANP00000004504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]