SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004505 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004505
Domain Number 1 Region: 39-212
Classification Level Classification E-value
Superfamily EF-hand 2.37e-31
Family Penta-EF-hand proteins 0.00000246
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004505   Gene: ENSPANG00000001067   Transcript: ENSPANT00000005615
Sequence length 214
Comment pep:novel scaffold:PapAnu2.0:JH685422.1:12097:12778:1 gene:ENSPANG00000001067 transcript:ENSPANT00000005615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSGNQFFSRGRRGGRVAMCFLGGIIISIMEVATQHNLEPLPPHTHCSNTEANKSEEVHQF
WRVFAQLAGDGIKVSGAELMNVLNKAVISRTELKTRGFGIDTCQSMVAMMDSDITGKLDF
EEFKYLWNNIKRSGTICTSELAWAFEAAGFHLNEQLQHNILHYLDEGGNIEFDNFISCLI
RSDASFHALKTLYKDDTRPLQVNIQEWLQLTMCF
Download sequence
Identical sequences ENSPANP00000004505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]