SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004507 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004507
Domain Number 1 Region: 11-266
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.43e-50
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.0012
Further Details:      
 
Domain Number 2 Region: 313-606
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.3e-24
Family Extended AAA-ATPase domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004507   Gene: ENSPANG00000012446   Transcript: ENSPANT00000016073
Sequence length 1146
Comment pep:known_by_projection chromosome:PapAnu2.0:4:143622583:143740693:1 gene:ENSPANG00000012446 transcript:ENSPANT00000016073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETNMEIGEYFNM
FPNEVLTVFDSALRRSALTILQSLSQSEGISMKQNLHARISGLPVCPELVREHIPKTKDV
GHFLSVTGTVIRTSLVKVLEFERDYMCTKCKHVFVVKADFEQYYTFCRPSSCPSLESCDS
SKFTCLSGLSSSPTRCRDYQEIKIQEQVQRLSVGSIPRSMKVILEDDLVDSCKSGDDLTI
YGVVMQRWKPFQQDVRCEVEIVLKANYIQVNNEQSIGIILKNKASKIGSKFWLIFLIFLL
FLGRNVILASLCPQVFGMYLVKLAVAMVLAGGIQRTDATGTRVRGESHLLLVGDPGTGKS
QFLKYAAKITPRSVLTTGIGSTSAGLTVTAVKDSGEWNLEAGALVLADAGLCCIDEFNSL
KEHDRTSIHEAMEQQTISVAKAGLCCKFQNQHSIADSVNLKKLYKDKPSDRFSVLLNALA
SPVMVTLDGVLIPLSTKXEDWDRIISSFILENKGYPSKSEKLWSMEKMKTYFCLIRNLQP
TLSDVGNQVLLRYYQMQRQSDSRNAARTTIRLLESLIRLAEAHARLMFRDTVTLEDAITV
VSVMESSMQGGALLGGVNALHTSFPENPGEQYQRQCELILEKLELQNLLSEELRRLERLQ
NQNVHQSQPPVLEVETTPGSLRNGPGEESNFRTSSQQEINCSTHIPSPGGSPEGSPVLDP
PAYLEPNRSTSRKHSADHKNSRDDSLDWFDFMATHQSEPKNTVLVSPHPKTSGENMASKI
SNSTSQGKEKSEPGQRNIVDVELLPSPGETGAPWRPDNVEGNKKKRLALDSEAVSADKPD
SVLTHHVPRNLQKLCKERAQKLCRNSTRVPAQCTVPSHPQSTPVHRPDRMLDSPKRKRPK
SLAQVEEPAIENVKPPGSPVAKLAKFTFKQKSKLIHSFEDHGHVSPGATKIAVHSPKISQ
HRTRRDAALPVKRPEKLTSTPGYRISDQLQDETKEVSQQPPEKYGRREKVMCAPEKRIIQ
PELELGNETGCAHLTCERDKEEEVSGSNKSGKVHACTLAKLANFCFTPPLESKSKSPPPE
RKNRGDRGPSSPPTTTAPVGVSKRKSFQLHRSTEKLIVSKESLFTLPELGDEAFDCDWDE
EMRKKS
Download sequence
Identical sequences ENSPANP00000004507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]