SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004522 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004522
Domain Number 1 Region: 1239-1347
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.41e-35
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 2 Region: 541-655
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-33
Family Spermadhesin, CUB domain 0.00078
Further Details:      
 
Domain Number 3 Region: 1762-1871
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-33
Family Spermadhesin, CUB domain 0.00053
Further Details:      
 
Domain Number 4 Region: 1585-1704
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.28e-32
Family Spermadhesin, CUB domain 0.00064
Further Details:      
 
Domain Number 5 Region: 377-481
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-31
Family Spermadhesin, CUB domain 0.00039
Further Details:      
 
Domain Number 6 Region: 242-344
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-30
Family Spermadhesin, CUB domain 0.00075
Further Details:      
 
Domain Number 7 Region: 70-173
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-28
Family Spermadhesin, CUB domain 0.00042
Further Details:      
 
Domain Number 8 Region: 1059-1180
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-27
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 9 Region: 1934-2041
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-26
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 10 Region: 2114-2218
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-26
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 11 Region: 892-1001
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-26
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 12 Region: 713-834
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-26
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 13 Region: 1407-1522
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-23
Family Spermadhesin, CUB domain 0.0058
Further Details:      
 
Domain Number 14 Region: 2468-2536
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.22e-18
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 15 Region: 2525-2592
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.59e-17
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 16 Region: 2409-2478
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.42e-17
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 17 Region: 1876-1944
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000082
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 18 Region: 178-239
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000189
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 19 Region: 1703-1765
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000283
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 20 Region: 2283-2350
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000005
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 21 Region: 1004-1067
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000148
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 22 Region: 1352-1419
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000148
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 23 Region: 2220-2287
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000148
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 24 Region: 661-721
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000167
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 25 Region: 1179-1242
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000195
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 26 Region: 2577-2644
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000162
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 27 Region: 2046-2110
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000216
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 28 Region: 1529-1592
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000032
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 29 Region: 486-554
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000347
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 30 Region: 834-896
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000742
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 31 Region: 2355-2420
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000121
Family Complement control module/SCR domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004522   Gene: ENSPANG00000010868   Transcript: ENSPANT00000013156
Sequence length 2646
Comment pep:novel chromosome:PapAnu2.0:1:35792297:36393298:-1 gene:ENSPANG00000010868 transcript:ENSPANT00000013156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSRGLELGRCGCPAGRARGEAGISALVPGARSRWGRPPPPTPPPLLLLLGWGLLSVSA
AAGQNCTFQLHGPNGTVESPGFPYGYPNYANCTWTITAEEQHRIQLVFQSFALEEDFDVL
SVFDGPPQPENLRTRLTGFQLPATIVSAATTLSLRLISDYAVSAQGFHATYEVLPSHTCG
NPGRLPNGIQQGSTFNLGDKVRYSCNPGFFLEGHAVLTCHAGSENSATWDFPLPSCRADD
ACGGTLRGQSGIISSPHFPSEYHNNADCTWTILAELGDTIALVFIDFQLEDGYDFLEVTG
TEGSSLWFTGASLPAPVISSKNWLRLHFTSDGNHRQRGFSAQYQVKKQIELKSRGVKLMP
SKDSSQKTSVFSCFFNFTSPSGIVLSPNYPEDYGNHLHCVWLILARPESRIHLAFNDIDV
EPQFDFLVIKDGATAEAPVLGTFSGNQLPSSITSSGHVARLEFQTDHSTGKRGFNITFTT
FRHNECPDPGVPVNGKRFGDSLQLGSSISFLCDEGFLGTQGSETITCVLKEGSVVWNSAV
LRCEAPCGGHLTSPSGTILSPGWPGFYKDALSCAWVIEAQPGYPIKITFDRFKTEVNYDT
LEVRDGRTYSAPLIGVYHGTQVPQFLISTSNYLYLLFSTDKSHSDIGFQLRYETITLQSD
HCLDPGIPVNGQRHGNDFYVGALVTFSCDSGYTLSDGEPLECEPNFQWSRALPSCEALCG
GFIQGSSGTILSPGFPDFYPNNLNCTWIIETSHGKGVFFTFHTFHLESGHDYLLITENGS
FTQPLRQLTGSRLPAPISAGLYGNFTAQVRFISDFSMSYEGFNITFSEYDLEPCEEPEVP
AYSIRKGLQFGVGDTLTFSCFPGYRLEGTARITCLGGRRRLWSSPLPRCVAECGNSVTGT
QGTLLSPNFPVNYNNNHECIYSIQTQPGKGIQLKARAFELSEGDVLKVYDGNNNSARLLG
VFSRSEMMGVTLNSTSSSLWLDFITDAENTSKGFELQFSSFELIKCEDPGTPQFGYKVHD
EGHFAGSSVSFSCDPGYSLRGSEELLCLSGERRTWDRPLPTCVAECGGTVKGEVSGQVLS
PGYPAPYEHNLNCIWTIEAEAGCTIGLHFLVFDTEEVHDVLRIWDGPVESGVLLKELSGP
ALPKDLHSTFNSVVLQFSTDFFTSKQGFAIQFSVSTATSCNDPGIPQNGSRSGDSWEAGD
STVFQCDPGYALQGSAEISCVKIENRFFWQPSPPTCIAPCGGDLTGPSGVILSPNYPEPY
PPGKECDWKVTVSPDYVIALVFNIFNLEPGYDFLHIYDGRDSLSPLIGSFYGSQLPGRIE
SSSNSLFLAFRSDASVSNAGFVIDYTENPRESCFDPGSIKNGTRVGSDLKLGSSVTYYCH
AGYEVEGASTLSCILGPDGKPVWNNPRPVCTAPCGGQYVGSDGVVLSPNYPQNYTSGQIC
LYFVTVPKDYVVFGQFAFFHTALNDVVEVHDGHSQHSRLLSSLSGSHTGESLPLATSNQV
LIKFSAKGLAPARGFHFVYQAVPRTSATQCSSVPEPRYGKRLGSDFSVGAIVRFECNSGY
ALQGSPEIECLPVPGALAQWNVSAPTCVVPCGGNLTERRGTILSPGFPEPYLNSLNCVWK
IVVPEGAGIQIQVISFVTEQNWDSLEVFDGADNTVTMLGSFSGTTVPALLNSTSNQLYLH
FYSDISVSAAGFHLEYKTVGLSSCPEPAVPSNGVKTGERYLVNDVVSFQCEPGYALQGHA
HISCMPGTVRRWNYPPPLCIAQCGGTVEEMEGVILSPGFPGNYPSNMDCSWKIALPVGFG
AHIQFLNFSTEPNHDYIEIRNGPYETSRMMGRFSGNELPSSLLSTSHETTVYFHSDHSQN
RPGFKLEYQAYELQECPDPEPFANGIVRGAGYNVGQSVTFECLPGYQLTGHPVLTCQHGT
NRNWDHPLPKCEVPCGGNITSSNGTVYSPGFPSPYSSSQDCVWLITVPIGHGVRLNLSLL
QTEPSGDFITIWDGPQQTAPRLGVFTRSMAKKTVHSSSNQVLLKFHRDAATGGIFAIAFS
AYPLTKCPPPTILPNAEVVTENEEFNIGDIVRYRCLPGFTLVGNEILTCKLGTYLQFEGP
PPICEVHCPTNELLTDSTGVILSQSYPGSYPQFQTCSWLVRVEPDYNISLTVEYFLSEKQ
YDEFEIFDGPSGQSPLLKALSGNYSAPLIVTSSSNSVYLRWSSDHAYNRKGFKIRYSAPY
CSLPRAPLHGFILGQTSTQPGGSIHFGCNAGYRLVGHSMAICTRHPQGYHLWSEAIPLCQ
ALSCGLPEAPKNGLVFGKEYTVGTKAVYSCSEGYHLQTGAEAAAECLDTGLWSNHNVPPQ
CIPVTCPDVSSISVEHGRWRLIFETQYQFQAQLMLICDPGYYYTGQRVIRCQANGKWSLG
DSTPTCRIISCGELPVPPNGHRIGTLSVYGATAIFSCNSGYTLVGSRVRECMANGLWSGS
EVRCLAGHCGTPEPIVNGHINGENYSYRGSVVYQCNAGFRLIGMSVRICQQDHHWSGKTP
FCVPITCGHPGNPVNGITQGNQFNLNDVVKFVCNPGYMAEGAARSQCLASGQWSDMLPTC
RIINCTDPGHQENSVRQVHASGPHRFSFGTTVSYQCNHGFYVLGTPVLSCQGDGTWDRPR
PQCLCK
Download sequence
Identical sequences ENSPANP00000004522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]