SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004558 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004558
Domain Number 1 Region: 92-114,192-392,419-544
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000777
Family FAD-linked reductases, N-terminal domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004558   Gene: ENSPANG00000017404   Transcript: ENSPANT00000006302
Sequence length 555
Comment pep:known_by_projection chromosome:PapAnu2.0:20:65674961:65691859:1 gene:ENSPANG00000017404 transcript:ENSPANT00000006302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKWRPRGSCQGNMQCRQEVPATLTSSEVFFTRTQPQPCADAPGPWAVVSRLYMTPGQGC
GHHGSPESPPPAPSPPPAMSSSGKDHLGASSSEPLPVIIVGNGPSGICLSYLLSGYTPYV
KPDAVHPHPLLQRKLTEAPGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGH
MKSVLTWKHQEEHAIPHVVLGRNLPGGAWHSIEGSMVTLSQGQWMGLPDLEVKDWMQKKR
RGLRNSRATAGDIAHYYRDYVVKKGLGHNFVSGAVVTAVEWGTPNPNSCGAQDSSPLFQV
SGFLSRDQGRQPFSLWARNVVLATGTFDSPARLGIPGEALPFIHHELSALEAATRVGALT
PASDPVLIIGAGLSAADAVLYARHYNIPVIHAFRRAVDDPGLVFNQLPKMLYPEYHKVHQ
MMREQSILSPSPYEGYRSLPGHRLLCFKEDCQAVFQDLKGVEKVFEVSLVLVLIGSHPDL
SFLPGAGADFAVDPDQPLSTKRNPIDVDPFTYQSTRQEGLYAMGPLAGDNFVRFVQGGAL
AVASSLLRKETRKPP
Download sequence
Identical sequences ENSPANP00000004558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]