SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004562 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004562
Domain Number 1 Region: 21-211
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000334
Family Tetratricopeptide repeat (TPR) 0.031
Further Details:      
 
Domain Number 2 Region: 157-223,253-275,311-357,407-457
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000325
Family Tetratricopeptide repeat (TPR) 0.037
Further Details:      
 
Domain Number 3 Region: 425-524
Classification Level Classification E-value
Superfamily TPR-like 0.000000375
Family HAT/Suf repeat 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004562   Gene: ENSPANG00000013745   Transcript: ENSPANT00000018170
Sequence length 665
Comment pep:known_by_projection chromosome:PapAnu2.0:12:39520160:39522157:-1 gene:ENSPANG00000013745 transcript:ENSPANT00000018170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLSGAQIPDGEFTAVVYRLIRGARYAEAVQLLGRELQRSPRSRAGLSLLGYCYYRLQE
FALAAECYEQLGQLHPELEQYRLYQAQALYKACLYPEATRVAFLLLDNPAYHSRVLRLQA
AIKYSEGDLPGSRSLVEQLLSGEGGEESGGENEMDGQVNLGCLLYKEGQYEAACSKFSAA
LQASGYQPDLSYNLALAYYSSRQYASALKHIAEIIERGIRQHPELGVGMTTEGFDVRSVG
NTLVLHQTALVEAFNLKAAIEYQLRNYEVAQETLTDMPPRAEEELDPVTLHNQALMNMDA
RPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLTYKFLTPYLYE
FLDAVITCQTAPEEAFIKLDGLAGMLTEQLRRLTKQVQEARHNRDDEAIKKAVNEYDETM
EKYIPVLMAQAKIYWNLENYPMVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIG
FYEPIVKKHYDNILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYDDPNRKM
YHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYNKKLGTDTWYYAKRCFLSLLENMSKH
MIAIHDSVIQECVQFLGHCELYGTNIPAVIEQPLEEERMHVGKNTVTDESRQLKALIYEI
IGWNK
Download sequence
Identical sequences A0A096MXE8
ENSPANP00000004562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]